Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8BW49

Protein Details
Accession A0A1B8BW49    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-89ISSSNNIKRDRAKRKAKKEEAEKKAKEKTNKBasic
NLS Segment(s)
PositionSequence
66-89KRDRAKRKAKKEEAEKKAKEKTNK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKQNGLRRYTRNSGGHHSSGEYSGVVHDAHIAKSGQVRVTEKITIAKSPSKAGNVTMVISSSNNIKRDRAKRKAKKEEAEKKAKEKTNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.57
3 0.5
4 0.45
5 0.37
6 0.32
7 0.27
8 0.19
9 0.12
10 0.1
11 0.11
12 0.09
13 0.07
14 0.1
15 0.1
16 0.1
17 0.12
18 0.12
19 0.11
20 0.14
21 0.16
22 0.14
23 0.16
24 0.18
25 0.18
26 0.2
27 0.2
28 0.18
29 0.2
30 0.19
31 0.17
32 0.18
33 0.19
34 0.18
35 0.2
36 0.21
37 0.19
38 0.19
39 0.18
40 0.2
41 0.17
42 0.17
43 0.14
44 0.13
45 0.11
46 0.11
47 0.11
48 0.13
49 0.17
50 0.2
51 0.22
52 0.25
53 0.34
54 0.44
55 0.54
56 0.59
57 0.66
58 0.72
59 0.82
60 0.9
61 0.91
62 0.91
63 0.91
64 0.92
65 0.9
66 0.91
67 0.86
68 0.83
69 0.83