Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CK12

Protein Details
Accession A0A1B8CK12    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
93-126CDNKDPYKAKREREKKEARKRRMEREGRRARFEDBasic
NLS Segment(s)
PositionSequence
100-135KAKREREKKEARKRRMEREGRRARFEDLKGGKGGRR
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MPAQTPTTKTHTPLTTTTGLTSQCLSTTPVCTVTNPKAVLQPNRIAKSQLRLTKERQEAIQALEMRAYLARRGQAQTQDVGTGKCECKEKCECDNKDPYKAKREREKKEARKRRMEREGRRARFEDLKGGKGGRREDWRVGEVGRMFEGMVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.36
4 0.34
5 0.3
6 0.27
7 0.24
8 0.23
9 0.17
10 0.14
11 0.14
12 0.16
13 0.14
14 0.15
15 0.16
16 0.18
17 0.19
18 0.2
19 0.25
20 0.27
21 0.31
22 0.3
23 0.3
24 0.32
25 0.37
26 0.41
27 0.4
28 0.43
29 0.44
30 0.46
31 0.46
32 0.43
33 0.39
34 0.41
35 0.43
36 0.42
37 0.39
38 0.4
39 0.44
40 0.51
41 0.53
42 0.47
43 0.4
44 0.38
45 0.34
46 0.32
47 0.32
48 0.24
49 0.2
50 0.18
51 0.17
52 0.14
53 0.14
54 0.12
55 0.07
56 0.08
57 0.09
58 0.11
59 0.13
60 0.15
61 0.17
62 0.18
63 0.18
64 0.17
65 0.17
66 0.16
67 0.14
68 0.13
69 0.13
70 0.12
71 0.14
72 0.18
73 0.17
74 0.22
75 0.29
76 0.33
77 0.39
78 0.48
79 0.5
80 0.52
81 0.62
82 0.59
83 0.63
84 0.65
85 0.61
86 0.61
87 0.64
88 0.65
89 0.66
90 0.73
91 0.7
92 0.74
93 0.8
94 0.81
95 0.86
96 0.89
97 0.87
98 0.89
99 0.89
100 0.88
101 0.88
102 0.88
103 0.86
104 0.87
105 0.89
106 0.83
107 0.82
108 0.74
109 0.68
110 0.65
111 0.56
112 0.55
113 0.48
114 0.45
115 0.41
116 0.41
117 0.39
118 0.37
119 0.39
120 0.36
121 0.41
122 0.43
123 0.47
124 0.5
125 0.5
126 0.47
127 0.43
128 0.42
129 0.36
130 0.32
131 0.26
132 0.21