Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8C351

Protein Details
Accession A0A1B8C351    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-68CLTCGRGGGRRKRSHGRHTTSAHydrophilic
NLS Segment(s)
PositionSequence
55-60GRRKRS
Subcellular Location(s) plas 18, vacu 5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVVSCITGIFRAIGAGLMAIVNGIGAILQGIIGAIVAFFDVLISCLTCGRGGGRRKRSHGRHTTSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.04
6 0.04
7 0.03
8 0.03
9 0.03
10 0.02
11 0.02
12 0.02
13 0.02
14 0.01
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.04
33 0.04
34 0.05
35 0.06
36 0.06
37 0.06
38 0.08
39 0.16
40 0.25
41 0.35
42 0.45
43 0.52
44 0.6
45 0.7
46 0.77
47 0.8
48 0.82
49 0.81