Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7YQA9

Protein Details
Accession C7YQA9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-83ITKAYRKKTRSLHPDKVKQQMRAHydrophilic
NLS Segment(s)
PositionSequence
66-102RKKTRSLHPDKVKQQMRAKAGKDKKAGAKPPTPAEIK
233-259RRERRMQEKAAKREGGRPAPKKTRRAP
398-408AKANKRKGKKR
Subcellular Location(s) cyto 7.5, extr 7, cyto_nucl 5.5, mito 4, E.R. 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG nhe:NECHADRAFT_37970  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MKISYLSVGLLALFSPLAAAWSKEDREIFRIRDEISRFEPDPAATFYDILGISNSASLDDITKAYRKKTRSLHPDKVKQQMRAKAGKDKKAGAKPPTPAEIKTAVKKAGEAQARLSLIANILRGPERDRYDHFLSNGFPLWKGTDYYYNRYRPGLGTVMIGLFFVVGGGIHYLTLYMSWKRQKEFVERYIKFARDTAWGGGLNIPGVDAAPAPAPAPVPSDDEEAPPPIPQNRRERRMQEKAAKREGGRPAPKKTRRAPQPASGTATPDTAGPTGARRRVVAENGKILVVDSLGDVYLEEEDEEGQVNEFLLDPNELAKPTFSDTAVVRVPIWFFNITAGRFLSKKTPELEIEIPADDDDSDVPQRTPSTDSAGEDFELLDKSTDSLSKSKASGVQQAKANKRKGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.06
5 0.07
6 0.08
7 0.11
8 0.17
9 0.19
10 0.23
11 0.27
12 0.28
13 0.33
14 0.39
15 0.38
16 0.37
17 0.39
18 0.38
19 0.41
20 0.41
21 0.41
22 0.39
23 0.43
24 0.39
25 0.39
26 0.38
27 0.32
28 0.32
29 0.29
30 0.27
31 0.21
32 0.2
33 0.18
34 0.19
35 0.18
36 0.15
37 0.13
38 0.1
39 0.1
40 0.11
41 0.11
42 0.07
43 0.08
44 0.07
45 0.08
46 0.09
47 0.1
48 0.12
49 0.17
50 0.2
51 0.26
52 0.33
53 0.35
54 0.43
55 0.51
56 0.59
57 0.64
58 0.72
59 0.76
60 0.8
61 0.86
62 0.85
63 0.86
64 0.82
65 0.79
66 0.78
67 0.75
68 0.72
69 0.7
70 0.67
71 0.67
72 0.69
73 0.69
74 0.65
75 0.64
76 0.65
77 0.66
78 0.7
79 0.67
80 0.65
81 0.62
82 0.61
83 0.6
84 0.54
85 0.46
86 0.42
87 0.41
88 0.39
89 0.39
90 0.39
91 0.35
92 0.33
93 0.33
94 0.32
95 0.33
96 0.33
97 0.29
98 0.27
99 0.3
100 0.3
101 0.29
102 0.26
103 0.19
104 0.15
105 0.16
106 0.14
107 0.09
108 0.1
109 0.11
110 0.12
111 0.14
112 0.19
113 0.21
114 0.24
115 0.28
116 0.33
117 0.37
118 0.4
119 0.38
120 0.33
121 0.31
122 0.29
123 0.29
124 0.22
125 0.17
126 0.15
127 0.16
128 0.14
129 0.15
130 0.14
131 0.21
132 0.24
133 0.3
134 0.37
135 0.39
136 0.39
137 0.39
138 0.39
139 0.3
140 0.3
141 0.26
142 0.19
143 0.16
144 0.15
145 0.14
146 0.12
147 0.11
148 0.07
149 0.05
150 0.04
151 0.03
152 0.02
153 0.02
154 0.02
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.04
162 0.06
163 0.07
164 0.12
165 0.17
166 0.2
167 0.22
168 0.26
169 0.3
170 0.37
171 0.43
172 0.47
173 0.52
174 0.5
175 0.55
176 0.55
177 0.52
178 0.43
179 0.37
180 0.3
181 0.22
182 0.23
183 0.18
184 0.16
185 0.15
186 0.14
187 0.15
188 0.13
189 0.1
190 0.08
191 0.07
192 0.05
193 0.04
194 0.04
195 0.03
196 0.03
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.05
203 0.07
204 0.08
205 0.1
206 0.11
207 0.14
208 0.14
209 0.15
210 0.16
211 0.15
212 0.14
213 0.12
214 0.13
215 0.15
216 0.19
217 0.24
218 0.34
219 0.41
220 0.46
221 0.53
222 0.58
223 0.63
224 0.68
225 0.7
226 0.69
227 0.7
228 0.73
229 0.73
230 0.69
231 0.61
232 0.59
233 0.57
234 0.57
235 0.57
236 0.56
237 0.57
238 0.65
239 0.7
240 0.72
241 0.72
242 0.72
243 0.73
244 0.77
245 0.73
246 0.71
247 0.72
248 0.67
249 0.66
250 0.56
251 0.49
252 0.4
253 0.35
254 0.26
255 0.19
256 0.16
257 0.11
258 0.11
259 0.08
260 0.12
261 0.18
262 0.21
263 0.22
264 0.21
265 0.25
266 0.28
267 0.34
268 0.37
269 0.35
270 0.35
271 0.35
272 0.34
273 0.3
274 0.27
275 0.2
276 0.12
277 0.09
278 0.05
279 0.05
280 0.04
281 0.04
282 0.04
283 0.04
284 0.05
285 0.04
286 0.04
287 0.04
288 0.05
289 0.05
290 0.06
291 0.05
292 0.06
293 0.06
294 0.06
295 0.06
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.08
302 0.09
303 0.09
304 0.1
305 0.1
306 0.1
307 0.13
308 0.15
309 0.14
310 0.15
311 0.15
312 0.2
313 0.21
314 0.2
315 0.17
316 0.17
317 0.18
318 0.16
319 0.18
320 0.14
321 0.13
322 0.17
323 0.21
324 0.2
325 0.21
326 0.21
327 0.2
328 0.2
329 0.22
330 0.25
331 0.25
332 0.29
333 0.29
334 0.33
335 0.33
336 0.39
337 0.39
338 0.34
339 0.32
340 0.29
341 0.27
342 0.21
343 0.2
344 0.14
345 0.12
346 0.09
347 0.1
348 0.12
349 0.13
350 0.13
351 0.15
352 0.16
353 0.18
354 0.21
355 0.2
356 0.24
357 0.25
358 0.28
359 0.28
360 0.29
361 0.27
362 0.23
363 0.22
364 0.16
365 0.15
366 0.13
367 0.11
368 0.09
369 0.1
370 0.12
371 0.14
372 0.16
373 0.19
374 0.22
375 0.25
376 0.26
377 0.29
378 0.34
379 0.36
380 0.42
381 0.44
382 0.47
383 0.49
384 0.58
385 0.64
386 0.67
387 0.72
388 0.71