Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8CJM3

Protein Details
Accession A0A1B8CJM3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-118AETMHRKRVERLKRKEKRNKMIKSBasic
NLS Segment(s)
PositionSequence
57-118KAKEKEMKEEKEAERQRRITALKDKRAAKEEKARYEKLAETMHRKRVERLKRKEKRNKMIKS
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTAVADAASQPAEKPAYGIRKNGKQWHALKSAFRPKAGNDTYEKRNAERVAMNVVKAKEKEMKEEKEAERQRRITALKDKRAAKEEKARYEKLAETMHRKRVERLKRKEKRNKMIKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.18
4 0.28
5 0.3
6 0.37
7 0.41
8 0.49
9 0.56
10 0.63
11 0.6
12 0.59
13 0.62
14 0.63
15 0.62
16 0.56
17 0.53
18 0.54
19 0.6
20 0.54
21 0.5
22 0.44
23 0.39
24 0.46
25 0.43
26 0.37
27 0.32
28 0.35
29 0.38
30 0.43
31 0.42
32 0.33
33 0.37
34 0.34
35 0.32
36 0.28
37 0.24
38 0.24
39 0.24
40 0.24
41 0.22
42 0.22
43 0.22
44 0.2
45 0.22
46 0.22
47 0.22
48 0.29
49 0.32
50 0.35
51 0.35
52 0.42
53 0.41
54 0.45
55 0.51
56 0.5
57 0.5
58 0.48
59 0.46
60 0.45
61 0.45
62 0.41
63 0.45
64 0.48
65 0.49
66 0.55
67 0.58
68 0.57
69 0.62
70 0.59
71 0.55
72 0.56
73 0.57
74 0.6
75 0.62
76 0.6
77 0.55
78 0.55
79 0.5
80 0.45
81 0.44
82 0.38
83 0.42
84 0.47
85 0.53
86 0.56
87 0.56
88 0.58
89 0.62
90 0.68
91 0.69
92 0.73
93 0.76
94 0.79
95 0.89
96 0.92
97 0.93
98 0.93