Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8C7B2

Protein Details
Accession A0A1B8C7B2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-81TSKLSPPPPRPAPFKRRRPLWDVDGSPHPTKKKRRLRLGLVTSRLHydrophilic
NLS Segment(s)
PositionSequence
44-73PPRPAPFKRRRPLWDVDGSPHPTKKKRRLR
Subcellular Location(s) mito 12, cyto 9, nucl 4
Family & Domain DBs
Amino Acid Sequences MTTTTTYHWVKTLTPALTPTTFTFTFVLTPSSKYTFTSKLSPPPPRPAPFKRRRPLWDVDGSPHPTKKKRRLRLGLVTSRLSRPFSSPASNIADRGVARVGSASWPVPRRPEKNELRKAAIMNRVRQRLSVLKAAQVKQSPPASVPQKRTHSQLVSALALRDVVAPMARTYEVPSQLPPSPLGLSNYDALDLEEEEGLGIDREGEDIDADMSGCGRGYYSDFSVRRSPRPEGEDYDYLDEMDGIPPLSLAEEPPPLPELPSLSIAKAEVGQLDDKVRVGMDIYIAGAAHGAGTYVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.32
4 0.32
5 0.33
6 0.28
7 0.27
8 0.26
9 0.26
10 0.25
11 0.21
12 0.21
13 0.19
14 0.22
15 0.17
16 0.19
17 0.21
18 0.23
19 0.23
20 0.24
21 0.28
22 0.29
23 0.32
24 0.37
25 0.37
26 0.43
27 0.51
28 0.59
29 0.59
30 0.64
31 0.69
32 0.68
33 0.72
34 0.73
35 0.76
36 0.77
37 0.82
38 0.81
39 0.82
40 0.83
41 0.8
42 0.77
43 0.74
44 0.72
45 0.64
46 0.59
47 0.57
48 0.56
49 0.53
50 0.51
51 0.5
52 0.49
53 0.57
54 0.63
55 0.66
56 0.71
57 0.78
58 0.83
59 0.86
60 0.88
61 0.88
62 0.85
63 0.79
64 0.73
65 0.64
66 0.58
67 0.51
68 0.42
69 0.33
70 0.28
71 0.28
72 0.28
73 0.29
74 0.27
75 0.29
76 0.33
77 0.33
78 0.3
79 0.25
80 0.24
81 0.2
82 0.21
83 0.17
84 0.1
85 0.09
86 0.09
87 0.09
88 0.08
89 0.09
90 0.09
91 0.12
92 0.15
93 0.17
94 0.24
95 0.31
96 0.35
97 0.39
98 0.49
99 0.54
100 0.62
101 0.7
102 0.67
103 0.64
104 0.62
105 0.58
106 0.53
107 0.51
108 0.45
109 0.43
110 0.46
111 0.46
112 0.43
113 0.42
114 0.4
115 0.36
116 0.35
117 0.35
118 0.29
119 0.29
120 0.34
121 0.35
122 0.35
123 0.31
124 0.28
125 0.27
126 0.28
127 0.23
128 0.19
129 0.24
130 0.28
131 0.32
132 0.37
133 0.39
134 0.44
135 0.45
136 0.48
137 0.46
138 0.4
139 0.36
140 0.34
141 0.28
142 0.24
143 0.23
144 0.19
145 0.14
146 0.13
147 0.11
148 0.08
149 0.05
150 0.05
151 0.04
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.09
158 0.13
159 0.14
160 0.15
161 0.15
162 0.18
163 0.19
164 0.2
165 0.18
166 0.16
167 0.15
168 0.16
169 0.17
170 0.15
171 0.15
172 0.15
173 0.14
174 0.13
175 0.12
176 0.11
177 0.09
178 0.08
179 0.07
180 0.05
181 0.05
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.03
188 0.03
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.05
204 0.07
205 0.09
206 0.12
207 0.2
208 0.21
209 0.25
210 0.33
211 0.36
212 0.41
213 0.43
214 0.45
215 0.44
216 0.49
217 0.49
218 0.47
219 0.5
220 0.47
221 0.45
222 0.44
223 0.37
224 0.31
225 0.27
226 0.21
227 0.15
228 0.12
229 0.1
230 0.06
231 0.06
232 0.06
233 0.06
234 0.07
235 0.06
236 0.07
237 0.09
238 0.11
239 0.12
240 0.14
241 0.16
242 0.15
243 0.16
244 0.16
245 0.17
246 0.16
247 0.21
248 0.21
249 0.19
250 0.19
251 0.18
252 0.18
253 0.16
254 0.14
255 0.11
256 0.12
257 0.13
258 0.14
259 0.16
260 0.16
261 0.15
262 0.15
263 0.14
264 0.12
265 0.11
266 0.11
267 0.09
268 0.09
269 0.09
270 0.09
271 0.09
272 0.08
273 0.07
274 0.06
275 0.05
276 0.04
277 0.04