Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CFJ7

Protein Details
Accession A0A1B8CFJ7   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28ISFVTKRTRQAQQPKKPKRTAKDYLVMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12mito_nucl 12, nucl 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MISFVTKRTRQAQQPKKPKRTAKDYLVMGRELSTKSQKPKDAEATKENVRGIWRKWSKFYAFQGVDDVQGAIQQCDKLTTMLFLCFIYENYKVKAFNSVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.89
4 0.91
5 0.9
6 0.88
7 0.86
8 0.84
9 0.81
10 0.78
11 0.73
12 0.7
13 0.63
14 0.54
15 0.44
16 0.37
17 0.31
18 0.23
19 0.22
20 0.22
21 0.24
22 0.31
23 0.36
24 0.41
25 0.41
26 0.46
27 0.53
28 0.51
29 0.52
30 0.48
31 0.47
32 0.44
33 0.44
34 0.38
35 0.29
36 0.27
37 0.25
38 0.22
39 0.28
40 0.32
41 0.31
42 0.34
43 0.38
44 0.39
45 0.42
46 0.44
47 0.44
48 0.38
49 0.37
50 0.37
51 0.32
52 0.29
53 0.23
54 0.19
55 0.09
56 0.1
57 0.1
58 0.07
59 0.08
60 0.08
61 0.08
62 0.09
63 0.1
64 0.09
65 0.09
66 0.11
67 0.11
68 0.11
69 0.12
70 0.11
71 0.11
72 0.11
73 0.12
74 0.14
75 0.17
76 0.2
77 0.22
78 0.26
79 0.25
80 0.25