Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CAD6

Protein Details
Accession A0A1B8CAD6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-31VANCNVPNKSRRKSNRNKIQRRRATAGIHydrophilic
54-73LSGKKARKVEKARNHARQRABasic
NLS Segment(s)
PositionSequence
12-33KSRRKSNRNKIQRRRATAGIAK
56-72GKKARKVEKARNHARQR
Subcellular Location(s) mito 15, mito_nucl 13.333, nucl 10.5, cyto_mito 8.833
Family & Domain DBs
Amino Acid Sequences MPSVANCNVPNKSRRKSNRNKIQRRRATAGIAKNPRGMALSTVIHPTSGPLAPLSGKKARKVEKARNHARQRALEKELAERGEVSMTDAPVTTKSKKKASEGAGADGMDVDEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.79
4 0.85
5 0.88
6 0.9
7 0.94
8 0.94
9 0.95
10 0.94
11 0.91
12 0.86
13 0.78
14 0.75
15 0.71
16 0.68
17 0.66
18 0.63
19 0.56
20 0.53
21 0.48
22 0.41
23 0.35
24 0.27
25 0.19
26 0.15
27 0.15
28 0.13
29 0.15
30 0.15
31 0.13
32 0.12
33 0.11
34 0.1
35 0.09
36 0.09
37 0.07
38 0.07
39 0.08
40 0.1
41 0.14
42 0.18
43 0.19
44 0.23
45 0.3
46 0.34
47 0.43
48 0.5
49 0.56
50 0.6
51 0.68
52 0.74
53 0.78
54 0.8
55 0.77
56 0.74
57 0.71
58 0.66
59 0.62
60 0.56
61 0.49
62 0.42
63 0.4
64 0.38
65 0.31
66 0.26
67 0.2
68 0.17
69 0.15
70 0.14
71 0.13
72 0.12
73 0.11
74 0.11
75 0.11
76 0.11
77 0.14
78 0.18
79 0.21
80 0.26
81 0.32
82 0.39
83 0.44
84 0.49
85 0.54
86 0.55
87 0.59
88 0.55
89 0.54
90 0.49
91 0.44
92 0.39
93 0.3
94 0.24