Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8BW83

Protein Details
Accession A0A1B8BW83    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-99EKKVEKIRAKRREKESQKEKKKIEKKNRKMEKENKKLEREREKEBasic
NLS Segment(s)
PositionSequence
57-109KKVEKIRAKRREKESQKEKKKIEKKNRKMEKENKKLEREREKEMGKKGGYKPR
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MASEPRTVNSFSNQLNLRRLEMQLESEELTHKRNLYVLEINRIRQERILNEEMDMEKKVEKIRAKRREKESQKEKKKIEKKNRKMEKENKKLEREREKEMGKKGGYKPRASFCWIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.39
4 0.38
5 0.35
6 0.35
7 0.31
8 0.27
9 0.25
10 0.21
11 0.21
12 0.18
13 0.16
14 0.18
15 0.16
16 0.18
17 0.17
18 0.16
19 0.15
20 0.17
21 0.17
22 0.19
23 0.25
24 0.24
25 0.31
26 0.33
27 0.33
28 0.36
29 0.36
30 0.32
31 0.27
32 0.28
33 0.21
34 0.26
35 0.28
36 0.23
37 0.22
38 0.23
39 0.21
40 0.2
41 0.18
42 0.11
43 0.09
44 0.11
45 0.12
46 0.16
47 0.2
48 0.28
49 0.38
50 0.49
51 0.57
52 0.64
53 0.7
54 0.76
55 0.8
56 0.81
57 0.82
58 0.82
59 0.84
60 0.85
61 0.83
62 0.83
63 0.84
64 0.84
65 0.84
66 0.85
67 0.85
68 0.87
69 0.91
70 0.89
71 0.9
72 0.9
73 0.9
74 0.89
75 0.89
76 0.86
77 0.85
78 0.84
79 0.83
80 0.84
81 0.77
82 0.74
83 0.72
84 0.7
85 0.68
86 0.67
87 0.65
88 0.57
89 0.6
90 0.61
91 0.63
92 0.63
93 0.63
94 0.63
95 0.63
96 0.65