Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8C2Z8

Protein Details
Accession A0A1B8C2Z8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-78AVSEVREKEEKRRKRNKRWAPWVERMMGHydrophilic
NLS Segment(s)
PositionSequence
58-68KEEKRRKRNKR
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MTGEHSESSQRRRDMERLRENLTAETNRLATVHTVPVETASDIAAIEADRAVSEVREKEEKRRKRNKRWAPWVERMMGISCAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.65
4 0.63
5 0.65
6 0.63
7 0.59
8 0.52
9 0.47
10 0.37
11 0.28
12 0.25
13 0.2
14 0.17
15 0.16
16 0.14
17 0.11
18 0.11
19 0.12
20 0.11
21 0.1
22 0.1
23 0.11
24 0.11
25 0.09
26 0.08
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.07
41 0.08
42 0.12
43 0.2
44 0.21
45 0.31
46 0.42
47 0.51
48 0.6
49 0.7
50 0.77
51 0.81
52 0.91
53 0.92
54 0.93
55 0.95
56 0.95
57 0.93
58 0.91
59 0.86
60 0.77
61 0.67
62 0.58
63 0.49