Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CM76

Protein Details
Accession A0A1B8CM76    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-66PGPPRAAKRVAKEKRKKAAEFBasic
NLS Segment(s)
PositionSequence
48-63PPRAAKRVAKEKRKKA
Subcellular Location(s) nucl 12, mito_nucl 11.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MSTAASDPSATTTTNGSNNASKKTPSLMLDKYLATPPTITENLAFPGPPRAAKRVAKEKRKKAAEFIEGWQAEWERMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.25
5 0.27
6 0.3
7 0.3
8 0.28
9 0.26
10 0.27
11 0.28
12 0.25
13 0.28
14 0.26
15 0.26
16 0.27
17 0.27
18 0.25
19 0.24
20 0.21
21 0.15
22 0.14
23 0.12
24 0.14
25 0.14
26 0.13
27 0.11
28 0.11
29 0.12
30 0.12
31 0.11
32 0.07
33 0.11
34 0.12
35 0.15
36 0.17
37 0.19
38 0.26
39 0.31
40 0.39
41 0.45
42 0.54
43 0.62
44 0.7
45 0.77
46 0.8
47 0.84
48 0.78
49 0.76
50 0.75
51 0.7
52 0.64
53 0.56
54 0.56
55 0.47
56 0.45
57 0.4
58 0.32