Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8C6C7

Protein Details
Accession A0A1B8C6C7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
33-59QGPTRSRTRCTKPRRRRREHCLPLSVHBasic
NLS Segment(s)
PositionSequence
45-49PRRRR
Subcellular Location(s) mito 13, extr 7, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MRAPASDGACVAVVWAPLHTTARSVQVHAQGGQGPTRSRTRCTKPRRRRREHCLPLSVHPPASSERGASARLGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.11
6 0.1
7 0.11
8 0.11
9 0.17
10 0.18
11 0.19
12 0.21
13 0.24
14 0.26
15 0.25
16 0.25
17 0.2
18 0.2
19 0.2
20 0.19
21 0.14
22 0.16
23 0.22
24 0.22
25 0.23
26 0.3
27 0.38
28 0.46
29 0.56
30 0.65
31 0.69
32 0.8
33 0.87
34 0.9
35 0.92
36 0.91
37 0.92
38 0.91
39 0.88
40 0.85
41 0.77
42 0.7
43 0.66
44 0.59
45 0.48
46 0.38
47 0.31
48 0.26
49 0.27
50 0.23
51 0.18
52 0.19
53 0.2
54 0.21
55 0.21