Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8CHM3

Protein Details
Accession A0A1B8CHM3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTRVPRGRPKKERIQKENSRGKRGLBasic
NLS Segment(s)
PositionSequence
5-24PRGRPKKERIQKENSRGKRG
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MTRVPRGRPKKERIQKENSRGKRGLNRDDVRPLADIIEVDGELLVRPSRSSYLRAGAMTTRFWLIGDLGKIGVAGAIGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.87
4 0.89
5 0.85
6 0.83
7 0.74
8 0.71
9 0.7
10 0.67
11 0.65
12 0.64
13 0.6
14 0.55
15 0.59
16 0.53
17 0.46
18 0.39
19 0.3
20 0.2
21 0.17
22 0.13
23 0.08
24 0.08
25 0.06
26 0.05
27 0.04
28 0.04
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.08
36 0.1
37 0.13
38 0.15
39 0.19
40 0.21
41 0.21
42 0.22
43 0.22
44 0.22
45 0.2
46 0.18
47 0.15
48 0.13
49 0.13
50 0.13
51 0.11
52 0.13
53 0.13
54 0.13
55 0.12
56 0.12
57 0.12
58 0.1
59 0.09
60 0.05