Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8CE16

Protein Details
Accession A0A1B8CE16    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-74GPTDDRRKRKSDRERRTDLYBasic
NLS Segment(s)
PositionSequence
61-64RKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MDSKIRIMVATESLVSSSLLPSSTSRLSQMQAAEAERNISDNELDIAVDETKLAGPTDDRRKRKSDRERRTDLYNDSPALFDFVNRSSCLRRILMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.08
5 0.07
6 0.07
7 0.09
8 0.09
9 0.13
10 0.14
11 0.14
12 0.17
13 0.18
14 0.18
15 0.2
16 0.19
17 0.17
18 0.17
19 0.18
20 0.16
21 0.15
22 0.15
23 0.12
24 0.12
25 0.1
26 0.09
27 0.07
28 0.06
29 0.07
30 0.06
31 0.06
32 0.05
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.05
41 0.04
42 0.05
43 0.13
44 0.24
45 0.33
46 0.37
47 0.41
48 0.48
49 0.55
50 0.65
51 0.69
52 0.7
53 0.72
54 0.76
55 0.81
56 0.78
57 0.77
58 0.72
59 0.66
60 0.62
61 0.55
62 0.47
63 0.39
64 0.36
65 0.29
66 0.26
67 0.21
68 0.14
69 0.13
70 0.14
71 0.17
72 0.17
73 0.2
74 0.22
75 0.26
76 0.3