Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CLD8

Protein Details
Accession A0A1B8CLD8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-33AAPLRRPPPLLRRQQAPKRTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007248  Mpv17_PMP22  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04117  Mpv17_PMP22  
Amino Acid Sequences MPGIILKAGLRAAAPLRRPPPLLRRQQAPKRTTTTNTPKTPPPGTTATPSPSTTIPTPGTLPPLPLWQRLGPLTTALSLFSRAQRARPWTTQFVSTLIVYFLGDLSAQRIGGGDYEPDRAGRALVIGAGAAIPSYTWFVYLGNCFNYTSPILSLLTKVVVNQLAFTPLFNTYFFGMQSLLSHPPSLSSLEHAVEHVKRTVPTSFINSCKLWPLVTAFSFTFLPPDFRNVFGGVVAIGWQAYLSFLNRKVEGGVEREEREEERRALDVGGGKEAGGESAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.35
4 0.39
5 0.42
6 0.47
7 0.53
8 0.57
9 0.64
10 0.61
11 0.67
12 0.74
13 0.8
14 0.83
15 0.77
16 0.74
17 0.7
18 0.69
19 0.64
20 0.64
21 0.65
22 0.65
23 0.67
24 0.63
25 0.63
26 0.64
27 0.64
28 0.55
29 0.49
30 0.45
31 0.42
32 0.42
33 0.41
34 0.38
35 0.37
36 0.36
37 0.33
38 0.28
39 0.29
40 0.26
41 0.26
42 0.24
43 0.22
44 0.24
45 0.23
46 0.28
47 0.24
48 0.24
49 0.2
50 0.27
51 0.28
52 0.28
53 0.31
54 0.26
55 0.29
56 0.28
57 0.28
58 0.2
59 0.19
60 0.17
61 0.14
62 0.13
63 0.11
64 0.1
65 0.11
66 0.12
67 0.14
68 0.2
69 0.2
70 0.22
71 0.27
72 0.33
73 0.37
74 0.42
75 0.45
76 0.44
77 0.45
78 0.45
79 0.4
80 0.35
81 0.3
82 0.24
83 0.19
84 0.13
85 0.11
86 0.09
87 0.08
88 0.06
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.08
108 0.07
109 0.06
110 0.05
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.02
121 0.03
122 0.03
123 0.04
124 0.04
125 0.05
126 0.06
127 0.08
128 0.09
129 0.09
130 0.1
131 0.1
132 0.1
133 0.11
134 0.11
135 0.1
136 0.09
137 0.09
138 0.09
139 0.09
140 0.09
141 0.08
142 0.08
143 0.08
144 0.08
145 0.08
146 0.09
147 0.09
148 0.09
149 0.09
150 0.1
151 0.1
152 0.1
153 0.09
154 0.09
155 0.1
156 0.09
157 0.1
158 0.09
159 0.1
160 0.1
161 0.09
162 0.09
163 0.08
164 0.09
165 0.1
166 0.12
167 0.12
168 0.12
169 0.11
170 0.12
171 0.13
172 0.14
173 0.12
174 0.11
175 0.13
176 0.13
177 0.14
178 0.13
179 0.16
180 0.15
181 0.17
182 0.16
183 0.16
184 0.16
185 0.18
186 0.19
187 0.18
188 0.19
189 0.24
190 0.27
191 0.28
192 0.32
193 0.3
194 0.29
195 0.3
196 0.29
197 0.22
198 0.19
199 0.19
200 0.19
201 0.19
202 0.21
203 0.18
204 0.19
205 0.2
206 0.18
207 0.18
208 0.14
209 0.17
210 0.15
211 0.21
212 0.2
213 0.21
214 0.23
215 0.22
216 0.21
217 0.17
218 0.17
219 0.11
220 0.09
221 0.08
222 0.06
223 0.05
224 0.04
225 0.04
226 0.04
227 0.05
228 0.06
229 0.08
230 0.13
231 0.17
232 0.21
233 0.22
234 0.23
235 0.22
236 0.25
237 0.26
238 0.25
239 0.28
240 0.29
241 0.29
242 0.31
243 0.32
244 0.31
245 0.32
246 0.34
247 0.3
248 0.28
249 0.28
250 0.27
251 0.25
252 0.26
253 0.27
254 0.23
255 0.24
256 0.21
257 0.19
258 0.19
259 0.19