Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8C582

Protein Details
Accession A0A1B8C582    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPDRSASKTKPFKPQRPSTGSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018552  CENP-X  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
GO:0051382  P:kinetochore assembly  
Pfam View protein in Pfam  
PF09415  CENP-X  
Amino Acid Sequences MPPDRSASKTKPFKPQRPSTGSTSSRAKPAPAPSSSRTTATTTTETPSSRPNPDDNDDDDAIAPDAPTETIPPAILTTLLTEFFADERTRISRGADKAVGKYMETFVREAIARAAYERGGEGRGDGFLEVEDLEKLAPQLVLDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.83
4 0.81
5 0.8
6 0.75
7 0.74
8 0.68
9 0.63
10 0.59
11 0.51
12 0.49
13 0.45
14 0.41
15 0.36
16 0.41
17 0.42
18 0.39
19 0.43
20 0.41
21 0.46
22 0.46
23 0.42
24 0.37
25 0.33
26 0.32
27 0.3
28 0.29
29 0.24
30 0.25
31 0.26
32 0.24
33 0.22
34 0.26
35 0.26
36 0.26
37 0.28
38 0.29
39 0.31
40 0.34
41 0.36
42 0.32
43 0.33
44 0.3
45 0.28
46 0.24
47 0.2
48 0.16
49 0.13
50 0.1
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.08
72 0.07
73 0.07
74 0.08
75 0.1
76 0.12
77 0.12
78 0.14
79 0.18
80 0.2
81 0.24
82 0.27
83 0.26
84 0.27
85 0.31
86 0.29
87 0.23
88 0.22
89 0.2
90 0.19
91 0.19
92 0.18
93 0.14
94 0.15
95 0.15
96 0.14
97 0.14
98 0.12
99 0.11
100 0.12
101 0.13
102 0.11
103 0.11
104 0.11
105 0.1
106 0.1
107 0.1
108 0.1
109 0.09
110 0.1
111 0.1
112 0.09
113 0.08
114 0.07
115 0.08
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.07
123 0.08
124 0.08