Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZMF6

Protein Details
Accession C7ZMF6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
137-157IESRKRKNIYGLGRPRKKVRGBasic
NLS Segment(s)
PositionSequence
130-157KELARGAIESRKRKNIYGLGRPRKKVRG
Subcellular Location(s) cyto_nucl 15, cyto 14.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
KEGG nhe:NECHADRAFT_106086  -  
CDD cd00024  CD_CSD  
Amino Acid Sequences MDPFLPILHRSYYVVDLNPDGDAPAASGSVGKPPAEVKDTSEVDELVKHRVHKDSSTVEFKVKWKGSDNLALVYNATKLELYYVFKILKRTKVPKGARPADNSKDAQYNYEHKSTLREIALDEFEKFKAKELARGAIESRKRKNIYGLGRPRKKVRGADN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.22
4 0.21
5 0.2
6 0.17
7 0.13
8 0.1
9 0.09
10 0.07
11 0.06
12 0.06
13 0.05
14 0.06
15 0.06
16 0.1
17 0.12
18 0.11
19 0.12
20 0.13
21 0.16
22 0.19
23 0.19
24 0.18
25 0.25
26 0.26
27 0.27
28 0.27
29 0.24
30 0.21
31 0.24
32 0.21
33 0.18
34 0.19
35 0.18
36 0.2
37 0.24
38 0.26
39 0.24
40 0.28
41 0.29
42 0.33
43 0.36
44 0.35
45 0.32
46 0.33
47 0.33
48 0.37
49 0.33
50 0.29
51 0.28
52 0.3
53 0.31
54 0.34
55 0.33
56 0.26
57 0.25
58 0.23
59 0.19
60 0.17
61 0.15
62 0.08
63 0.07
64 0.05
65 0.04
66 0.06
67 0.07
68 0.08
69 0.09
70 0.11
71 0.12
72 0.14
73 0.2
74 0.22
75 0.27
76 0.33
77 0.38
78 0.42
79 0.51
80 0.55
81 0.56
82 0.63
83 0.64
84 0.61
85 0.61
86 0.62
87 0.56
88 0.56
89 0.51
90 0.43
91 0.4
92 0.35
93 0.31
94 0.28
95 0.3
96 0.29
97 0.3
98 0.28
99 0.24
100 0.28
101 0.28
102 0.29
103 0.23
104 0.2
105 0.19
106 0.21
107 0.24
108 0.21
109 0.2
110 0.16
111 0.17
112 0.2
113 0.19
114 0.19
115 0.24
116 0.23
117 0.29
118 0.32
119 0.37
120 0.35
121 0.37
122 0.36
123 0.37
124 0.44
125 0.46
126 0.49
127 0.52
128 0.54
129 0.54
130 0.6
131 0.61
132 0.62
133 0.64
134 0.69
135 0.7
136 0.76
137 0.81
138 0.8
139 0.79
140 0.78