Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CIF8

Protein Details
Accession A0A1B8CIF8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-79PTRAAPPTPKPKSRRRIPRPRLQNQYIYHydrophilic
NLS Segment(s)
PositionSequence
57-72PPTPKPKSRRRIPRPR
Subcellular Location(s) cyto 10, mito 9, nucl 7
Family & Domain DBs
Amino Acid Sequences MTAPFEVAPRRQSPAISAMATMAGAGAADVLETKGIDAVAKSEAPATAPMEPTRAAPPTPKPKSRRRIPRPRLQNQYIYAHPAPTLNSILVAEAARPTTAAEADEAEIDWRLLAAAAAKRGRNPSVTSNETALFTPAMSITSLASTLVDRASVHSSTTAAGSQAASADRYGWEESLSARSSLDLGSRASEETTRDYRGGADMMAPPPAAAQERAQERGFMGKRGLLWKVLTMNARGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.29
4 0.26
5 0.22
6 0.2
7 0.19
8 0.15
9 0.1
10 0.05
11 0.04
12 0.03
13 0.03
14 0.02
15 0.02
16 0.03
17 0.03
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.06
24 0.06
25 0.07
26 0.09
27 0.09
28 0.09
29 0.1
30 0.1
31 0.1
32 0.12
33 0.13
34 0.13
35 0.15
36 0.15
37 0.16
38 0.17
39 0.18
40 0.19
41 0.19
42 0.17
43 0.2
44 0.29
45 0.38
46 0.45
47 0.52
48 0.56
49 0.65
50 0.74
51 0.8
52 0.82
53 0.82
54 0.86
55 0.87
56 0.9
57 0.9
58 0.89
59 0.89
60 0.82
61 0.78
62 0.71
63 0.66
64 0.56
65 0.52
66 0.43
67 0.34
68 0.29
69 0.23
70 0.2
71 0.17
72 0.17
73 0.1
74 0.1
75 0.1
76 0.09
77 0.09
78 0.08
79 0.06
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.05
102 0.06
103 0.1
104 0.12
105 0.12
106 0.14
107 0.17
108 0.18
109 0.18
110 0.19
111 0.22
112 0.26
113 0.28
114 0.28
115 0.27
116 0.27
117 0.25
118 0.23
119 0.18
120 0.12
121 0.09
122 0.07
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.07
138 0.1
139 0.1
140 0.11
141 0.1
142 0.11
143 0.11
144 0.12
145 0.1
146 0.07
147 0.07
148 0.07
149 0.06
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.1
157 0.1
158 0.09
159 0.09
160 0.09
161 0.1
162 0.14
163 0.15
164 0.13
165 0.12
166 0.12
167 0.12
168 0.12
169 0.13
170 0.1
171 0.1
172 0.11
173 0.12
174 0.12
175 0.13
176 0.13
177 0.14
178 0.18
179 0.21
180 0.22
181 0.21
182 0.21
183 0.21
184 0.21
185 0.2
186 0.14
187 0.14
188 0.15
189 0.15
190 0.16
191 0.15
192 0.13
193 0.12
194 0.14
195 0.14
196 0.12
197 0.13
198 0.19
199 0.24
200 0.28
201 0.28
202 0.27
203 0.26
204 0.35
205 0.34
206 0.3
207 0.28
208 0.26
209 0.29
210 0.33
211 0.34
212 0.27
213 0.27
214 0.28
215 0.29
216 0.32
217 0.31