Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8B8T4

Protein Details
Accession A0A1B8B8T4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
185-210AVFITCCSGRRRKSREQKKMAAYSSSHydrophilic
NLS Segment(s)
PositionSequence
196-197RK
Subcellular Location(s) plas 20, mito 3, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MGFGRFIHYVGAFFLLAATVMLVVVSITAPVVDHIALLKVRYGGDGVNYGTFGYCQMRSTGSNTCSKARIGYDPTDAFNGLDLSEIGSGTAKALTYVMVLHPIGAGLCFISFLLALGAGIFGSLMSTLISIAAFLVTIIALACDFAGLSIIRRRINRDTSATASWSVGIWLVLAAAILCLIGTIAVFITCCSGRRRKSREQKKMAAYSSSPTRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.07
4 0.07
5 0.06
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.04
18 0.05
19 0.05
20 0.05
21 0.06
22 0.08
23 0.09
24 0.09
25 0.1
26 0.1
27 0.11
28 0.11
29 0.11
30 0.09
31 0.1
32 0.12
33 0.12
34 0.11
35 0.11
36 0.1
37 0.1
38 0.09
39 0.09
40 0.1
41 0.1
42 0.1
43 0.11
44 0.13
45 0.14
46 0.18
47 0.23
48 0.23
49 0.29
50 0.31
51 0.32
52 0.31
53 0.31
54 0.3
55 0.25
56 0.27
57 0.25
58 0.25
59 0.28
60 0.27
61 0.28
62 0.26
63 0.24
64 0.19
65 0.16
66 0.13
67 0.08
68 0.07
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.04
85 0.06
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.04
92 0.04
93 0.02
94 0.02
95 0.03
96 0.02
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.02
104 0.03
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.04
134 0.04
135 0.06
136 0.1
137 0.15
138 0.19
139 0.2
140 0.26
141 0.32
142 0.38
143 0.41
144 0.42
145 0.43
146 0.44
147 0.44
148 0.4
149 0.35
150 0.29
151 0.24
152 0.19
153 0.14
154 0.1
155 0.08
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.03
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.07
176 0.08
177 0.11
178 0.17
179 0.26
180 0.35
181 0.45
182 0.54
183 0.62
184 0.73
185 0.82
186 0.87
187 0.88
188 0.89
189 0.89
190 0.89
191 0.82
192 0.77
193 0.67
194 0.62