Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AJ97

Protein Details
Accession A0A1B8AJ97    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-58ISESNRPRTRKKVEPSRVRRARREAQHydrophilic
NLS Segment(s)
PositionSequence
38-55RPRTRKKVEPSRVRRARR
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSAGAPPPPNNPGPSGHDFSGSDLSDVPTEAISESNRPRTRKKVEPSRVRRARREAQLAAAASAADAVPAIRRVVPCLPCLRSALAGSSLGDCWDEPDQARYERCNPGGSCTLVPLAARPVALFFLDFLASIYDNPARSQKTELAKRRAAVKVVLKGCADGTFPSVGDPHLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.41
4 0.37
5 0.37
6 0.35
7 0.35
8 0.36
9 0.29
10 0.23
11 0.19
12 0.19
13 0.16
14 0.16
15 0.14
16 0.08
17 0.08
18 0.08
19 0.09
20 0.09
21 0.15
22 0.19
23 0.29
24 0.34
25 0.38
26 0.44
27 0.52
28 0.58
29 0.62
30 0.68
31 0.7
32 0.75
33 0.82
34 0.85
35 0.86
36 0.88
37 0.85
38 0.83
39 0.8
40 0.78
41 0.75
42 0.73
43 0.63
44 0.57
45 0.54
46 0.46
47 0.38
48 0.29
49 0.21
50 0.13
51 0.12
52 0.08
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.06
60 0.07
61 0.1
62 0.15
63 0.17
64 0.18
65 0.22
66 0.23
67 0.23
68 0.24
69 0.22
70 0.18
71 0.17
72 0.15
73 0.12
74 0.11
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.06
81 0.07
82 0.07
83 0.08
84 0.07
85 0.1
86 0.12
87 0.14
88 0.16
89 0.17
90 0.21
91 0.24
92 0.26
93 0.28
94 0.26
95 0.28
96 0.31
97 0.3
98 0.25
99 0.21
100 0.2
101 0.16
102 0.16
103 0.12
104 0.11
105 0.09
106 0.09
107 0.08
108 0.08
109 0.09
110 0.09
111 0.08
112 0.06
113 0.07
114 0.07
115 0.07
116 0.06
117 0.07
118 0.07
119 0.07
120 0.09
121 0.11
122 0.11
123 0.13
124 0.18
125 0.19
126 0.2
127 0.24
128 0.28
129 0.36
130 0.45
131 0.53
132 0.57
133 0.59
134 0.6
135 0.63
136 0.61
137 0.54
138 0.51
139 0.49
140 0.5
141 0.48
142 0.49
143 0.42
144 0.38
145 0.37
146 0.31
147 0.25
148 0.17
149 0.17
150 0.14
151 0.14
152 0.14
153 0.14