Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AY51

Protein Details
Accession A0A1B8AY51    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-110CCWYPCCRPRLQNRRRRRQRTRRGPPATDEEHydrophilic
NLS Segment(s)
PositionSequence
92-103NRRRRRQRTRRG
Subcellular Location(s) plas 16, mito 4, cyto 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPILSTWHLVPRGDHASSPESDDSSTSGTTGNIVPSNAFADDLFREKFMGIAKGGSNGEKIMRGFLIGLAIGLVVACFVCCWYPCCRPRLQNRRRRRQRTRRGPPATDEEQNATNRPPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.27
4 0.27
5 0.31
6 0.25
7 0.21
8 0.2
9 0.2
10 0.18
11 0.16
12 0.15
13 0.11
14 0.1
15 0.09
16 0.1
17 0.11
18 0.11
19 0.1
20 0.1
21 0.1
22 0.1
23 0.12
24 0.1
25 0.1
26 0.08
27 0.08
28 0.09
29 0.12
30 0.12
31 0.11
32 0.11
33 0.11
34 0.12
35 0.12
36 0.12
37 0.09
38 0.1
39 0.1
40 0.12
41 0.13
42 0.12
43 0.11
44 0.09
45 0.1
46 0.1
47 0.1
48 0.08
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.04
68 0.07
69 0.13
70 0.22
71 0.27
72 0.31
73 0.38
74 0.45
75 0.56
76 0.65
77 0.7
78 0.71
79 0.78
80 0.86
81 0.91
82 0.93
83 0.94
84 0.94
85 0.95
86 0.96
87 0.96
88 0.96
89 0.94
90 0.87
91 0.82
92 0.79
93 0.73
94 0.66
95 0.57
96 0.5
97 0.45
98 0.43
99 0.39
100 0.33