Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8B7R0

Protein Details
Accession A0A1B8B7R0   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
135-164KDVSDKDAAKNRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
106-114GGRKRKVGK
131-156DKKKKDVSDKDAAKNRKPKKKAKKIK
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, nucl 11, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MASTPKINSKNLSYDNAAPPFLAALRAQAAGATGPDPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVSLEVDKDGVVKDTGDHDAEPTVVKEVTKESESKAAIGGRKRKVGKVVGGDSDEAKAEGDGEDKKKKDVSDKDAAKNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.47
4 0.43
5 0.34
6 0.29
7 0.26
8 0.22
9 0.17
10 0.1
11 0.09
12 0.11
13 0.11
14 0.11
15 0.1
16 0.1
17 0.08
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.11
26 0.13
27 0.13
28 0.18
29 0.27
30 0.34
31 0.39
32 0.46
33 0.47
34 0.53
35 0.59
36 0.62
37 0.61
38 0.59
39 0.58
40 0.56
41 0.5
42 0.43
43 0.36
44 0.28
45 0.21
46 0.16
47 0.12
48 0.07
49 0.05
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.07
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.06
77 0.07
78 0.06
79 0.06
80 0.06
81 0.08
82 0.1
83 0.11
84 0.11
85 0.11
86 0.17
87 0.17
88 0.17
89 0.17
90 0.18
91 0.2
92 0.26
93 0.33
94 0.32
95 0.39
96 0.4
97 0.41
98 0.44
99 0.45
100 0.44
101 0.43
102 0.43
103 0.38
104 0.38
105 0.36
106 0.31
107 0.27
108 0.21
109 0.14
110 0.11
111 0.08
112 0.07
113 0.06
114 0.08
115 0.12
116 0.18
117 0.25
118 0.25
119 0.28
120 0.31
121 0.33
122 0.4
123 0.45
124 0.47
125 0.51
126 0.58
127 0.64
128 0.7
129 0.75
130 0.74
131 0.75
132 0.77
133 0.77
134 0.79
135 0.81
136 0.83
137 0.88
138 0.91
139 0.92
140 0.93
141 0.92
142 0.94
143 0.93
144 0.9