Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AK33

Protein Details
Accession A0A1B8AK33    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
96-117KEQLRVTRSKRGNNRARRDDGSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.333, nucl 11.5, cyto 10, cyto_mito 6.999, mito 2.5
Family & Domain DBs
Amino Acid Sequences MNYQHQLPAVPENSVVTTWQQPAPLPPQATNPACFVSRLAGELLLSRTDNMNLRHASTQLQRDVGCWRQEYDRLLVEYWKVLEHNATLLGQVSRLKEQLRVTRSKRGNNRARRDDGSVSIPVSTGSSDSDAANDLVAGGSDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.14
4 0.17
5 0.19
6 0.2
7 0.19
8 0.19
9 0.23
10 0.27
11 0.3
12 0.28
13 0.26
14 0.3
15 0.38
16 0.39
17 0.36
18 0.33
19 0.29
20 0.28
21 0.27
22 0.22
23 0.16
24 0.14
25 0.14
26 0.12
27 0.1
28 0.1
29 0.11
30 0.11
31 0.1
32 0.1
33 0.09
34 0.09
35 0.11
36 0.15
37 0.15
38 0.2
39 0.19
40 0.21
41 0.22
42 0.22
43 0.23
44 0.23
45 0.26
46 0.22
47 0.23
48 0.21
49 0.21
50 0.25
51 0.26
52 0.24
53 0.2
54 0.2
55 0.2
56 0.22
57 0.23
58 0.21
59 0.19
60 0.17
61 0.17
62 0.16
63 0.15
64 0.13
65 0.11
66 0.09
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.07
76 0.07
77 0.08
78 0.1
79 0.11
80 0.11
81 0.13
82 0.14
83 0.18
84 0.23
85 0.3
86 0.33
87 0.4
88 0.43
89 0.51
90 0.57
91 0.61
92 0.66
93 0.69
94 0.73
95 0.75
96 0.82
97 0.8
98 0.81
99 0.75
100 0.71
101 0.64
102 0.57
103 0.51
104 0.42
105 0.34
106 0.27
107 0.24
108 0.18
109 0.15
110 0.12
111 0.09
112 0.08
113 0.1
114 0.11
115 0.11
116 0.11
117 0.12
118 0.12
119 0.11
120 0.1
121 0.08
122 0.07