Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8B5U8

Protein Details
Accession A0A1B8B5U8   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-99ENVTPGPPEKPPKRPKRKATSKKNKSKKPKRRABasic
NLS Segment(s)
PositionSequence
74-99PEKPPKRPKRKATSKKNKSKKPKRRA
Subcellular Location(s) mito 9, plas 5, extr 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYIVIWFRNFLISALWAIAISIGRIFGCERALKKQLYVAGSRFGISSWATTNTKPATTTERLLEWMENVTPGPPEKPPKRPKRKATSKKNKSKKPKRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.09
4 0.08
5 0.08
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.06
12 0.07
13 0.07
14 0.1
15 0.13
16 0.15
17 0.21
18 0.26
19 0.25
20 0.25
21 0.27
22 0.28
23 0.27
24 0.28
25 0.23
26 0.21
27 0.21
28 0.21
29 0.18
30 0.14
31 0.13
32 0.1
33 0.1
34 0.08
35 0.12
36 0.12
37 0.12
38 0.16
39 0.16
40 0.16
41 0.16
42 0.16
43 0.19
44 0.2
45 0.22
46 0.2
47 0.2
48 0.21
49 0.21
50 0.2
51 0.14
52 0.13
53 0.11
54 0.1
55 0.1
56 0.08
57 0.08
58 0.09
59 0.1
60 0.14
61 0.23
62 0.29
63 0.4
64 0.5
65 0.61
66 0.71
67 0.8
68 0.86
69 0.88
70 0.93
71 0.94
72 0.94
73 0.95
74 0.94
75 0.95
76 0.96
77 0.95
78 0.95
79 0.95