Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YP31

Protein Details
Accession C7YP31    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
105-128GMTALKPRDRSKKKAKAKKKKAAABasic
NLS Segment(s)
PositionSequence
70-80AKGKKERAKKI
110-128KPRDRSKKKAKAKKKKAAA
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG nhe:NECHADRAFT_78620  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MADPRISHDEFFAKLAELFDHRKGSDHGTVVLSQKRLTYGQDIPAPSEEEPSPDLHPGKPLPLIIRATNAKGKKERAKKIKLTTVVNPEDLEAFYVRYADVCKAGMTALKPRDRSKKKAKAKKKKAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.16
5 0.19
6 0.22
7 0.25
8 0.24
9 0.26
10 0.27
11 0.3
12 0.31
13 0.28
14 0.26
15 0.24
16 0.26
17 0.28
18 0.3
19 0.25
20 0.21
21 0.2
22 0.21
23 0.2
24 0.2
25 0.21
26 0.19
27 0.23
28 0.27
29 0.26
30 0.26
31 0.26
32 0.26
33 0.21
34 0.21
35 0.16
36 0.13
37 0.14
38 0.15
39 0.14
40 0.15
41 0.16
42 0.14
43 0.17
44 0.15
45 0.16
46 0.15
47 0.15
48 0.13
49 0.16
50 0.17
51 0.15
52 0.18
53 0.17
54 0.19
55 0.24
56 0.24
57 0.25
58 0.27
59 0.33
60 0.39
61 0.47
62 0.55
63 0.59
64 0.66
65 0.7
66 0.73
67 0.75
68 0.72
69 0.66
70 0.63
71 0.61
72 0.55
73 0.47
74 0.4
75 0.32
76 0.27
77 0.23
78 0.18
79 0.1
80 0.09
81 0.08
82 0.08
83 0.07
84 0.07
85 0.09
86 0.09
87 0.1
88 0.1
89 0.1
90 0.1
91 0.1
92 0.12
93 0.13
94 0.2
95 0.27
96 0.32
97 0.36
98 0.44
99 0.55
100 0.6
101 0.67
102 0.71
103 0.74
104 0.79
105 0.86
106 0.9
107 0.9
108 0.94