Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8ALN2

Protein Details
Accession A0A1B8ALN2    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-95APSPPAKKTPGRKRGPKPKTPKMVGBasic
100-124DDYESLKKSTPRKRRAPKTEIDDENHydrophilic
NLS Segment(s)
PositionSequence
74-92PPAKKTPGRKRGPKPKTPK
108-115STPRKRRA
Subcellular Location(s) nucl 18, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MSDILTPKTNAWTDEAKNELLLRIIAQLKPEGKSINWNEITMEGRTMKSLQNQWTAFNKKIDALKQQAADAPSPPAKKTPGRKRGPKPKTPKMVGSDEDDDYESLKKSTPRKRRAPKTEIDDENSTKAIKMEINETIKAEDGEFDHEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.29
4 0.29
5 0.28
6 0.25
7 0.19
8 0.17
9 0.12
10 0.14
11 0.16
12 0.16
13 0.17
14 0.21
15 0.22
16 0.23
17 0.25
18 0.22
19 0.19
20 0.28
21 0.3
22 0.35
23 0.33
24 0.32
25 0.31
26 0.31
27 0.32
28 0.23
29 0.22
30 0.14
31 0.13
32 0.14
33 0.15
34 0.15
35 0.18
36 0.23
37 0.26
38 0.32
39 0.32
40 0.35
41 0.41
42 0.43
43 0.41
44 0.37
45 0.33
46 0.29
47 0.31
48 0.31
49 0.28
50 0.28
51 0.29
52 0.28
53 0.28
54 0.27
55 0.25
56 0.22
57 0.17
58 0.16
59 0.16
60 0.16
61 0.16
62 0.16
63 0.18
64 0.24
65 0.34
66 0.42
67 0.48
68 0.56
69 0.66
70 0.75
71 0.82
72 0.85
73 0.84
74 0.84
75 0.83
76 0.84
77 0.78
78 0.74
79 0.68
80 0.64
81 0.56
82 0.52
83 0.45
84 0.36
85 0.33
86 0.27
87 0.22
88 0.18
89 0.17
90 0.12
91 0.1
92 0.12
93 0.16
94 0.24
95 0.35
96 0.44
97 0.53
98 0.63
99 0.74
100 0.83
101 0.88
102 0.86
103 0.85
104 0.83
105 0.82
106 0.76
107 0.71
108 0.65
109 0.57
110 0.52
111 0.44
112 0.36
113 0.27
114 0.23
115 0.19
116 0.16
117 0.15
118 0.17
119 0.23
120 0.27
121 0.28
122 0.29
123 0.28
124 0.27
125 0.26
126 0.22
127 0.16
128 0.13