Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AY23

Protein Details
Accession A0A1B8AY23    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-25REGGKVKPLKQAKKAQKDLDBasic
NLS Segment(s)
PositionSequence
34-68KKRADEKARKELAAKAGGKGPLNTGGQGIKKSGKK
Subcellular Location(s) nucl 18, mito 5, pero 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MGGANREGGKVKPLKQAKKAQKDLDEDDMAYLEKKRADEKARKELAAKAGGKGPLNTGGQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.7
4 0.72
5 0.77
6 0.8
7 0.77
8 0.74
9 0.72
10 0.67
11 0.62
12 0.52
13 0.41
14 0.33
15 0.27
16 0.21
17 0.16
18 0.12
19 0.08
20 0.09
21 0.09
22 0.11
23 0.16
24 0.24
25 0.31
26 0.38
27 0.47
28 0.49
29 0.49
30 0.49
31 0.48
32 0.46
33 0.45
34 0.39
35 0.3
36 0.31
37 0.33
38 0.32
39 0.29
40 0.25
41 0.23
42 0.23
43 0.22
44 0.2
45 0.21
46 0.23
47 0.24
48 0.25