Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8B753

Protein Details
Accession A0A1B8B753   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AKSARASTRKANNRRLVKNVFHydrophilic
76-105DSVKKPSSGRIEKKRPDKRRQQASKIVFKSHydrophilic
NLS Segment(s)
PositionSequence
79-119KKPSSGRIEKKRPDKRRQQASKIVFKSYSSRSKGKGKKKSA
Subcellular Location(s) nucl 17, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASTRKANNRRLVKNVFGPAEAARNERLSAKLLEVAKQPKPESSDVNMNTQEDETNESNEEAQDETTMDVDSVKKPSSGRIEKKRPDKRRQQASKIVFKSYSSRSKGKGKKKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.76
5 0.71
6 0.68
7 0.64
8 0.56
9 0.46
10 0.41
11 0.34
12 0.33
13 0.28
14 0.23
15 0.19
16 0.19
17 0.19
18 0.19
19 0.19
20 0.17
21 0.17
22 0.16
23 0.19
24 0.18
25 0.2
26 0.24
27 0.27
28 0.28
29 0.31
30 0.31
31 0.28
32 0.31
33 0.31
34 0.3
35 0.28
36 0.33
37 0.3
38 0.34
39 0.32
40 0.29
41 0.27
42 0.23
43 0.2
44 0.12
45 0.15
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.07
54 0.06
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.05
61 0.05
62 0.07
63 0.08
64 0.1
65 0.11
66 0.12
67 0.12
68 0.18
69 0.27
70 0.36
71 0.44
72 0.52
73 0.62
74 0.69
75 0.8
76 0.85
77 0.86
78 0.87
79 0.88
80 0.88
81 0.89
82 0.91
83 0.89
84 0.88
85 0.87
86 0.87
87 0.79
88 0.73
89 0.63
90 0.55
91 0.52
92 0.5
93 0.5
94 0.46
95 0.48
96 0.49
97 0.59
98 0.66
99 0.71