Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8A3R3

Protein Details
Accession A0A1B8A3R3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
115-144CLHTRRLSLAIKKRRRRRPKTDGSPHLSSQHydrophilic
NLS Segment(s)
PositionSequence
124-134AIKKRRRRRPK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSYPQSSSLPSTPDMEPPCPGQRDPSSNIDLRSAAASSSAPPQCIDNAYQKRFSFQTHGVTQDSCQSRQLDTLLRLYSELKMEVTKLKDDNRKLNRRVRLCEKYKYFQSNRNRPCLHTRRLSLAIKKRRRRRPKTDGSPHLSSQVIPCTPTIEHVVHESGIYQTDSEDEVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.3
4 0.32
5 0.37
6 0.37
7 0.36
8 0.36
9 0.39
10 0.43
11 0.46
12 0.47
13 0.45
14 0.45
15 0.46
16 0.4
17 0.34
18 0.28
19 0.24
20 0.18
21 0.13
22 0.11
23 0.1
24 0.09
25 0.17
26 0.17
27 0.16
28 0.17
29 0.18
30 0.18
31 0.2
32 0.21
33 0.24
34 0.31
35 0.34
36 0.4
37 0.39
38 0.4
39 0.4
40 0.39
41 0.35
42 0.3
43 0.34
44 0.3
45 0.33
46 0.31
47 0.3
48 0.28
49 0.29
50 0.28
51 0.22
52 0.23
53 0.21
54 0.2
55 0.21
56 0.23
57 0.19
58 0.18
59 0.21
60 0.18
61 0.17
62 0.17
63 0.17
64 0.16
65 0.13
66 0.12
67 0.08
68 0.08
69 0.09
70 0.12
71 0.12
72 0.13
73 0.14
74 0.2
75 0.26
76 0.29
77 0.38
78 0.45
79 0.53
80 0.57
81 0.63
82 0.65
83 0.64
84 0.68
85 0.67
86 0.67
87 0.64
88 0.66
89 0.64
90 0.61
91 0.63
92 0.65
93 0.59
94 0.58
95 0.63
96 0.65
97 0.65
98 0.69
99 0.64
100 0.58
101 0.65
102 0.65
103 0.61
104 0.58
105 0.55
106 0.52
107 0.58
108 0.6
109 0.58
110 0.6
111 0.64
112 0.66
113 0.74
114 0.77
115 0.82
116 0.87
117 0.89
118 0.9
119 0.9
120 0.91
121 0.93
122 0.94
123 0.92
124 0.89
125 0.84
126 0.74
127 0.66
128 0.55
129 0.44
130 0.36
131 0.32
132 0.26
133 0.21
134 0.2
135 0.2
136 0.19
137 0.21
138 0.23
139 0.17
140 0.18
141 0.2
142 0.22
143 0.19
144 0.19
145 0.17
146 0.13
147 0.15
148 0.14
149 0.11
150 0.09
151 0.1