Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AKB1

Protein Details
Accession A0A1B8AKB1   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
247-276YDNLKDERRKWVWRLRQKRNPKGFRPMPAWHydrophilic
NLS Segment(s)
PositionSequence
254-273RRKWVWRLRQKRNPKGFRPM
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MATTNFHRSPLSDVVRELDPNAPPPAPLDLLSTVSSLFARRQEKLRQEELALQDAEEEARYVAARAAARKRIEKEAEEEAELLDRLERALVITPRIKDTEPSKEEIEALVDNEIAKEEKGPGLRRAKHETAEEYEKRMVALEYRVDCLDIIEKERKQKEPVHYVDGFPTNVVIIDRHVRPIPETPAGNFSCLQCEVLGRRCGRRSDNERICEPCARIGRRCLVKHQWTQESKLLKSWKFAKSQRFGYDNLKDERRKWVWRLRQKRNPKGFRPMPAWPVKKGSNVETDQQNTPKRWQDYLRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.36
4 0.32
5 0.27
6 0.23
7 0.25
8 0.27
9 0.24
10 0.21
11 0.23
12 0.24
13 0.21
14 0.2
15 0.2
16 0.18
17 0.21
18 0.22
19 0.2
20 0.16
21 0.16
22 0.15
23 0.13
24 0.14
25 0.19
26 0.22
27 0.25
28 0.32
29 0.4
30 0.49
31 0.55
32 0.57
33 0.52
34 0.5
35 0.53
36 0.5
37 0.46
38 0.37
39 0.29
40 0.25
41 0.22
42 0.2
43 0.13
44 0.11
45 0.05
46 0.06
47 0.06
48 0.06
49 0.07
50 0.1
51 0.12
52 0.18
53 0.24
54 0.3
55 0.34
56 0.4
57 0.42
58 0.47
59 0.49
60 0.46
61 0.44
62 0.45
63 0.43
64 0.38
65 0.34
66 0.26
67 0.23
68 0.2
69 0.16
70 0.09
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.1
77 0.11
78 0.14
79 0.18
80 0.19
81 0.21
82 0.23
83 0.23
84 0.22
85 0.26
86 0.32
87 0.31
88 0.33
89 0.32
90 0.31
91 0.31
92 0.27
93 0.24
94 0.14
95 0.12
96 0.09
97 0.08
98 0.07
99 0.07
100 0.07
101 0.06
102 0.05
103 0.06
104 0.06
105 0.09
106 0.13
107 0.16
108 0.23
109 0.31
110 0.36
111 0.4
112 0.47
113 0.47
114 0.46
115 0.46
116 0.42
117 0.38
118 0.41
119 0.37
120 0.32
121 0.31
122 0.27
123 0.25
124 0.22
125 0.17
126 0.11
127 0.12
128 0.12
129 0.12
130 0.13
131 0.13
132 0.13
133 0.13
134 0.12
135 0.12
136 0.09
137 0.11
138 0.15
139 0.17
140 0.24
141 0.27
142 0.29
143 0.31
144 0.37
145 0.4
146 0.45
147 0.46
148 0.46
149 0.43
150 0.41
151 0.4
152 0.35
153 0.28
154 0.19
155 0.16
156 0.09
157 0.09
158 0.09
159 0.06
160 0.06
161 0.1
162 0.1
163 0.13
164 0.13
165 0.13
166 0.15
167 0.19
168 0.21
169 0.21
170 0.21
171 0.2
172 0.26
173 0.26
174 0.26
175 0.23
176 0.19
177 0.18
178 0.18
179 0.17
180 0.11
181 0.12
182 0.14
183 0.19
184 0.25
185 0.24
186 0.29
187 0.32
188 0.37
189 0.39
190 0.46
191 0.47
192 0.53
193 0.59
194 0.58
195 0.58
196 0.57
197 0.56
198 0.51
199 0.44
200 0.39
201 0.39
202 0.39
203 0.39
204 0.4
205 0.45
206 0.5
207 0.5
208 0.52
209 0.54
210 0.58
211 0.62
212 0.65
213 0.66
214 0.61
215 0.64
216 0.62
217 0.58
218 0.5
219 0.49
220 0.5
221 0.41
222 0.45
223 0.48
224 0.48
225 0.51
226 0.56
227 0.59
228 0.59
229 0.65
230 0.66
231 0.6
232 0.58
233 0.58
234 0.59
235 0.55
236 0.54
237 0.55
238 0.51
239 0.5
240 0.57
241 0.55
242 0.55
243 0.56
244 0.61
245 0.64
246 0.72
247 0.81
248 0.82
249 0.86
250 0.9
251 0.93
252 0.94
253 0.93
254 0.9
255 0.9
256 0.86
257 0.83
258 0.78
259 0.74
260 0.72
261 0.72
262 0.68
263 0.61
264 0.6
265 0.56
266 0.57
267 0.54
268 0.49
269 0.48
270 0.48
271 0.5
272 0.51
273 0.51
274 0.5
275 0.54
276 0.56
277 0.51
278 0.55
279 0.58
280 0.54
281 0.57
282 0.58