Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8AN43

Protein Details
Accession A0A1B8AN43    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
102-128TSTYLSFRSRRDRRPRNRSRSRGTSRAHydrophilic
188-214EEHSVSTPPRRSRRRSQDKYRRDPLMGHydrophilic
220-243SRDYSPRDYSPPRRDSRRRYSRDRBasic
NLS Segment(s)
PositionSequence
110-150SRRDRRPRNRSRSRGTSRATSRSKRTRSRTTVQSRDRSRRR
Subcellular Location(s) nucl 10, cyto_nucl 9.5, cyto 7, mito 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPAIPPSTTIPSDPSHHGLLAVRQNDDSRTSFTAVPTAYKSADTSLHPGAVAGIVLGSVAAFLLLLYLIYMLLHRGPVVRPMGDGASTVASGYPMSTVTGDTSTYLSFRSRRDRRPRNRSRSRGTSRATSRSKRTRSRTTVQSRDRSRRRGSPLVSESQASRVIVDPPAPRFVQDSMLSSDNEIVVEEEHSVSTPPRRSRRRSQDKYRRDPLMGDGYRSSRDYSPRDYSPPRRDSRRRYSRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.28
4 0.28
5 0.26
6 0.3
7 0.33
8 0.31
9 0.28
10 0.28
11 0.29
12 0.29
13 0.32
14 0.27
15 0.24
16 0.25
17 0.26
18 0.26
19 0.25
20 0.28
21 0.24
22 0.24
23 0.23
24 0.22
25 0.2
26 0.19
27 0.19
28 0.17
29 0.2
30 0.19
31 0.21
32 0.2
33 0.2
34 0.19
35 0.18
36 0.16
37 0.13
38 0.11
39 0.06
40 0.04
41 0.03
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.07
64 0.11
65 0.14
66 0.13
67 0.13
68 0.14
69 0.14
70 0.13
71 0.13
72 0.09
73 0.08
74 0.07
75 0.07
76 0.06
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.08
93 0.09
94 0.12
95 0.15
96 0.25
97 0.32
98 0.42
99 0.53
100 0.63
101 0.71
102 0.8
103 0.87
104 0.88
105 0.91
106 0.9
107 0.87
108 0.86
109 0.82
110 0.79
111 0.71
112 0.68
113 0.62
114 0.62
115 0.61
116 0.55
117 0.57
118 0.59
119 0.65
120 0.65
121 0.69
122 0.7
123 0.7
124 0.72
125 0.74
126 0.74
127 0.76
128 0.74
129 0.76
130 0.73
131 0.77
132 0.77
133 0.74
134 0.7
135 0.68
136 0.68
137 0.67
138 0.62
139 0.6
140 0.57
141 0.54
142 0.49
143 0.42
144 0.35
145 0.29
146 0.29
147 0.19
148 0.16
149 0.12
150 0.13
151 0.13
152 0.17
153 0.17
154 0.17
155 0.21
156 0.2
157 0.2
158 0.2
159 0.21
160 0.22
161 0.2
162 0.21
163 0.21
164 0.22
165 0.22
166 0.2
167 0.2
168 0.15
169 0.13
170 0.11
171 0.08
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.08
179 0.09
180 0.15
181 0.22
182 0.3
183 0.4
184 0.49
185 0.57
186 0.67
187 0.77
188 0.82
189 0.85
190 0.88
191 0.89
192 0.91
193 0.94
194 0.91
195 0.85
196 0.75
197 0.67
198 0.61
199 0.61
200 0.51
201 0.45
202 0.4
203 0.37
204 0.38
205 0.37
206 0.34
207 0.28
208 0.34
209 0.36
210 0.4
211 0.44
212 0.46
213 0.52
214 0.59
215 0.65
216 0.68
217 0.72
218 0.73
219 0.77
220 0.83
221 0.85
222 0.87
223 0.88