Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AFH5

Protein Details
Accession A0A1B8AFH5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-48EEQVDQEKPQRKTKTKKSKGERRKRRARFDDYDDEBasic
NLS Segment(s)
PositionSequence
21-41KPQRKTKTKKSKGERRKRRAR
Subcellular Location(s) nucl 21.5, cyto_nucl 14.333, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSSSAEQRSDLEEEQVDQEKPQRKTKTKKSKGERRKRRARFDDYDDEQDNNQMAQSNYNAQQQQMQQQQQQQQMQQQQQQQQQQGGGGGKSDALSLHLELNLEIEIQLKARIHGDLTLCLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.25
4 0.22
5 0.19
6 0.25
7 0.31
8 0.35
9 0.43
10 0.49
11 0.55
12 0.65
13 0.76
14 0.8
15 0.82
16 0.88
17 0.9
18 0.91
19 0.93
20 0.94
21 0.94
22 0.93
23 0.94
24 0.93
25 0.93
26 0.91
27 0.89
28 0.84
29 0.81
30 0.79
31 0.72
32 0.68
33 0.59
34 0.5
35 0.41
36 0.35
37 0.27
38 0.18
39 0.14
40 0.1
41 0.09
42 0.09
43 0.09
44 0.11
45 0.13
46 0.17
47 0.17
48 0.15
49 0.18
50 0.18
51 0.24
52 0.28
53 0.29
54 0.28
55 0.33
56 0.39
57 0.41
58 0.42
59 0.38
60 0.37
61 0.41
62 0.43
63 0.43
64 0.42
65 0.43
66 0.47
67 0.5
68 0.47
69 0.42
70 0.38
71 0.33
72 0.31
73 0.25
74 0.19
75 0.14
76 0.12
77 0.1
78 0.1
79 0.09
80 0.07
81 0.07
82 0.08
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.11
89 0.09
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.11
96 0.1
97 0.11
98 0.13
99 0.14
100 0.14
101 0.17
102 0.19
103 0.18