Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8ABN8

Protein Details
Accession A0A1B8ABN8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-73AFKDAKRLLPREKKKERDKRDKNVSEFVGBasic
NLS Segment(s)
PositionSequence
49-65AKRLLPREKKKERDKRD
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGQFHRQQSVCHFDNGREFQNVITRNVKDHFKNYIKDRVQQAKDAFKDAKRLLPREKKKERDKRDKNVSEFVGNTDNRDDHHDSDDYAWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.4
4 0.34
5 0.32
6 0.28
7 0.33
8 0.33
9 0.28
10 0.3
11 0.28
12 0.29
13 0.32
14 0.35
15 0.31
16 0.32
17 0.37
18 0.37
19 0.42
20 0.44
21 0.51
22 0.48
23 0.51
24 0.55
25 0.55
26 0.51
27 0.51
28 0.49
29 0.46
30 0.45
31 0.43
32 0.38
33 0.29
34 0.34
35 0.29
36 0.32
37 0.3
38 0.34
39 0.4
40 0.48
41 0.57
42 0.61
43 0.7
44 0.74
45 0.8
46 0.87
47 0.88
48 0.89
49 0.89
50 0.89
51 0.91
52 0.9
53 0.84
54 0.8
55 0.72
56 0.64
57 0.54
58 0.47
59 0.43
60 0.34
61 0.31
62 0.27
63 0.25
64 0.23
65 0.29
66 0.3
67 0.25
68 0.29
69 0.28
70 0.27