Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AD40

Protein Details
Accession A0A1B8AD40    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
104-130NEKSAATTPKQPKKRGRKPKSASPADAHydrophilic
NLS Segment(s)
PositionSequence
32-101PPVKRGRGRPPKGSAPMPKKVYVPTGRPRGRPPGGGKKKAAPTPKKVAAVNDDGTPKRGRGRPRRAAVAE
104-124NEKSAATTPKQPKKRGRKPKS
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MARTKEDVASKGDSSPKIPKSSAGVTKNTAEPPVKRGRGRPPKGSAPMPKKVYVPTGRPRGRPPGGGKKKAAPTPKKVAAVNDDGTPKRGRGRPRRAAVAEDENEKSAATTPKQPKKRGRKPKSASPADASADEDKGDDAADDVSDKEASVADSPDRDEEDDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.41
4 0.41
5 0.41
6 0.39
7 0.39
8 0.46
9 0.5
10 0.46
11 0.45
12 0.43
13 0.45
14 0.46
15 0.42
16 0.38
17 0.33
18 0.3
19 0.33
20 0.4
21 0.43
22 0.43
23 0.48
24 0.55
25 0.62
26 0.67
27 0.69
28 0.66
29 0.68
30 0.7
31 0.72
32 0.7
33 0.66
34 0.68
35 0.63
36 0.58
37 0.51
38 0.47
39 0.48
40 0.43
41 0.43
42 0.43
43 0.5
44 0.53
45 0.54
46 0.56
47 0.57
48 0.54
49 0.53
50 0.52
51 0.53
52 0.58
53 0.61
54 0.58
55 0.56
56 0.59
57 0.58
58 0.6
59 0.55
60 0.52
61 0.55
62 0.58
63 0.55
64 0.5
65 0.46
66 0.41
67 0.38
68 0.33
69 0.27
70 0.24
71 0.21
72 0.23
73 0.21
74 0.18
75 0.2
76 0.23
77 0.3
78 0.38
79 0.49
80 0.56
81 0.6
82 0.66
83 0.62
84 0.6
85 0.55
86 0.51
87 0.42
88 0.36
89 0.33
90 0.26
91 0.24
92 0.22
93 0.18
94 0.14
95 0.16
96 0.14
97 0.23
98 0.32
99 0.41
100 0.49
101 0.58
102 0.65
103 0.73
104 0.82
105 0.84
106 0.84
107 0.87
108 0.86
109 0.88
110 0.89
111 0.85
112 0.78
113 0.71
114 0.66
115 0.57
116 0.5
117 0.42
118 0.33
119 0.26
120 0.22
121 0.17
122 0.13
123 0.11
124 0.1
125 0.07
126 0.06
127 0.05
128 0.06
129 0.06
130 0.06
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.09
137 0.1
138 0.12
139 0.12
140 0.14
141 0.16
142 0.18
143 0.19
144 0.19
145 0.19