Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8A9X1

Protein Details
Accession A0A1B8A9X1   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-39EQMAQLRRGKKRKAVPNPNRRFMTLHydrophilic
84-104VVTKHCQRTRSGREVKKPRRQBasic
NLS Segment(s)
PositionSequence
21-29RRGKKRKAV
98-103VKKPRR
Subcellular Location(s) cyto 10, mito 9.5, mito_nucl 9, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MKVAVQNARITGLEEQMAQLRRGKKRKAVPNPNRRFMTLAETLAAGEALPDSKDAEIEVVVDEEVESVIEVGVRSEDESEDFMVVTKHCQRTRSGREVKKPRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.18
4 0.2
5 0.19
6 0.23
7 0.29
8 0.37
9 0.46
10 0.51
11 0.54
12 0.62
13 0.71
14 0.77
15 0.81
16 0.82
17 0.85
18 0.88
19 0.88
20 0.8
21 0.7
22 0.61
23 0.51
24 0.46
25 0.38
26 0.29
27 0.21
28 0.19
29 0.17
30 0.15
31 0.13
32 0.07
33 0.04
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.09
71 0.09
72 0.13
73 0.2
74 0.28
75 0.3
76 0.33
77 0.38
78 0.48
79 0.57
80 0.62
81 0.65
82 0.66
83 0.75
84 0.84