Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7Z625

Protein Details
Accession C7Z625    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-36FYPGQPCWKKAKREALPEPKAEHydrophilic
249-268QSQWNHSKRDDKQVDKRWCFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, pero 3
Family & Domain DBs
KEGG nhe:NECHADRAFT_105880  -  
Amino Acid Sequences MAAPAPDAEPEPWCFYPGQPCWKKAKREALPEPKAEPVAEAKASPWCFYPGQPCWKKAKRDADADAEAKPWCFYPGQPCWKVKRAAEAFSEVLQVSGNEARSADADAEADLSNLAGGAAFRAKREIHELANVISLATRDDSGNYYRSLNLERAFPADSDPKAKRDAEPWCIYPGQPCWKNKRNASPEAKAKAEAAEQKDKRWCFYPGQPCWKAKRAADAVVEALGDDEEAEAPQTPNYRPTPWGFFPGQSQWNHSKRDDKQVDKRWCFYPGQPCWKAKRDIDAIRTAARSITEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.33
4 0.37
5 0.45
6 0.45
7 0.5
8 0.59
9 0.67
10 0.73
11 0.72
12 0.76
13 0.74
14 0.78
15 0.83
16 0.84
17 0.83
18 0.78
19 0.71
20 0.63
21 0.56
22 0.46
23 0.37
24 0.3
25 0.27
26 0.24
27 0.21
28 0.19
29 0.25
30 0.26
31 0.25
32 0.22
33 0.22
34 0.22
35 0.25
36 0.32
37 0.32
38 0.42
39 0.48
40 0.52
41 0.59
42 0.65
43 0.7
44 0.71
45 0.75
46 0.7
47 0.72
48 0.71
49 0.67
50 0.65
51 0.59
52 0.5
53 0.41
54 0.35
55 0.27
56 0.23
57 0.16
58 0.12
59 0.11
60 0.13
61 0.19
62 0.28
63 0.38
64 0.43
65 0.48
66 0.53
67 0.59
68 0.62
69 0.55
70 0.56
71 0.5
72 0.48
73 0.45
74 0.43
75 0.37
76 0.32
77 0.32
78 0.22
79 0.18
80 0.14
81 0.11
82 0.09
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.09
89 0.1
90 0.08
91 0.07
92 0.06
93 0.06
94 0.08
95 0.07
96 0.06
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.02
103 0.02
104 0.03
105 0.06
106 0.06
107 0.07
108 0.09
109 0.1
110 0.11
111 0.17
112 0.18
113 0.17
114 0.19
115 0.2
116 0.18
117 0.19
118 0.18
119 0.12
120 0.1
121 0.09
122 0.06
123 0.06
124 0.06
125 0.05
126 0.06
127 0.08
128 0.09
129 0.11
130 0.11
131 0.11
132 0.11
133 0.13
134 0.14
135 0.14
136 0.14
137 0.13
138 0.13
139 0.14
140 0.14
141 0.13
142 0.14
143 0.15
144 0.14
145 0.19
146 0.2
147 0.2
148 0.23
149 0.24
150 0.22
151 0.25
152 0.3
153 0.31
154 0.33
155 0.32
156 0.32
157 0.32
158 0.3
159 0.27
160 0.27
161 0.29
162 0.32
163 0.35
164 0.42
165 0.49
166 0.57
167 0.6
168 0.66
169 0.63
170 0.67
171 0.7
172 0.68
173 0.68
174 0.65
175 0.6
176 0.5
177 0.44
178 0.35
179 0.32
180 0.29
181 0.27
182 0.33
183 0.32
184 0.36
185 0.43
186 0.42
187 0.41
188 0.39
189 0.37
190 0.32
191 0.4
192 0.46
193 0.47
194 0.57
195 0.6
196 0.62
197 0.65
198 0.66
199 0.63
200 0.54
201 0.55
202 0.48
203 0.47
204 0.44
205 0.39
206 0.33
207 0.28
208 0.26
209 0.16
210 0.13
211 0.08
212 0.06
213 0.04
214 0.04
215 0.04
216 0.04
217 0.05
218 0.06
219 0.06
220 0.08
221 0.11
222 0.12
223 0.18
224 0.22
225 0.24
226 0.26
227 0.3
228 0.36
229 0.35
230 0.4
231 0.36
232 0.34
233 0.36
234 0.39
235 0.41
236 0.35
237 0.39
238 0.43
239 0.47
240 0.5
241 0.49
242 0.52
243 0.51
244 0.61
245 0.64
246 0.64
247 0.69
248 0.74
249 0.82
250 0.79
251 0.78
252 0.7
253 0.65
254 0.59
255 0.56
256 0.56
257 0.53
258 0.57
259 0.58
260 0.6
261 0.64
262 0.68
263 0.68
264 0.62
265 0.63
266 0.62
267 0.65
268 0.66
269 0.65
270 0.61
271 0.57
272 0.55
273 0.46
274 0.38