Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8ANB4

Protein Details
Accession A0A1B8ANB4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
183-209PRKPRATAPKTPKRAPKRKAPAKSASIHydrophilic
NLS Segment(s)
PositionSequence
183-205PRKPRATAPKTPKRAPKRKAPAK
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, cyto 4.5, plas 2, E.R. 2, mito 1, extr 1, pero 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPGKASDWDNAEFLMDLVVGLYTGAQTNKGLTPAIKESIEDYLKARGYSTSFDAVRLRRGLSIKSPHMASSPLPTTSPLSTSPFYFSFLQLVLSLIYLSIYSSNITMVKRQVMVWDANVHEDILISLFQHIKPSSDDWTNVMNDLQGKGYSFTESALRQHVQKLRKNRDTAGIQNSGSEAGTPRKPRATAPKTPKRAPKRKAPAKSASIPDEDEEDLEDMKLQLKMEETDVGDDSLLSPKGVKRARTATPKAEPEADDELDSSEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.08
3 0.06
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.06
11 0.07
12 0.08
13 0.08
14 0.11
15 0.13
16 0.14
17 0.15
18 0.13
19 0.18
20 0.21
21 0.24
22 0.22
23 0.21
24 0.21
25 0.27
26 0.27
27 0.23
28 0.21
29 0.23
30 0.25
31 0.24
32 0.23
33 0.18
34 0.19
35 0.21
36 0.23
37 0.23
38 0.22
39 0.24
40 0.29
41 0.28
42 0.31
43 0.3
44 0.28
45 0.26
46 0.28
47 0.29
48 0.32
49 0.38
50 0.36
51 0.37
52 0.37
53 0.33
54 0.33
55 0.31
56 0.24
57 0.22
58 0.21
59 0.19
60 0.19
61 0.19
62 0.21
63 0.2
64 0.21
65 0.17
66 0.19
67 0.19
68 0.19
69 0.22
70 0.2
71 0.22
72 0.21
73 0.19
74 0.16
75 0.16
76 0.15
77 0.12
78 0.12
79 0.08
80 0.07
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.06
91 0.08
92 0.08
93 0.1
94 0.11
95 0.13
96 0.13
97 0.13
98 0.14
99 0.14
100 0.14
101 0.13
102 0.15
103 0.13
104 0.13
105 0.14
106 0.12
107 0.09
108 0.08
109 0.07
110 0.05
111 0.05
112 0.04
113 0.05
114 0.06
115 0.06
116 0.09
117 0.09
118 0.09
119 0.11
120 0.12
121 0.14
122 0.15
123 0.15
124 0.15
125 0.17
126 0.16
127 0.15
128 0.13
129 0.11
130 0.1
131 0.1
132 0.09
133 0.07
134 0.07
135 0.08
136 0.08
137 0.09
138 0.08
139 0.08
140 0.1
141 0.11
142 0.12
143 0.14
144 0.15
145 0.15
146 0.21
147 0.26
148 0.31
149 0.36
150 0.46
151 0.52
152 0.58
153 0.6
154 0.56
155 0.58
156 0.56
157 0.56
158 0.51
159 0.45
160 0.37
161 0.34
162 0.33
163 0.25
164 0.2
165 0.15
166 0.11
167 0.11
168 0.17
169 0.2
170 0.22
171 0.25
172 0.27
173 0.31
174 0.41
175 0.44
176 0.49
177 0.57
178 0.64
179 0.68
180 0.75
181 0.8
182 0.8
183 0.83
184 0.79
185 0.79
186 0.8
187 0.83
188 0.85
189 0.83
190 0.81
191 0.77
192 0.78
193 0.73
194 0.65
195 0.57
196 0.49
197 0.41
198 0.35
199 0.28
200 0.21
201 0.17
202 0.14
203 0.12
204 0.11
205 0.11
206 0.08
207 0.1
208 0.11
209 0.1
210 0.1
211 0.12
212 0.13
213 0.15
214 0.18
215 0.16
216 0.17
217 0.18
218 0.17
219 0.15
220 0.14
221 0.13
222 0.14
223 0.13
224 0.11
225 0.13
226 0.14
227 0.24
228 0.29
229 0.31
230 0.34
231 0.41
232 0.5
233 0.58
234 0.63
235 0.63
236 0.67
237 0.69
238 0.66
239 0.63
240 0.55
241 0.5
242 0.49
243 0.41
244 0.33
245 0.28