Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8B552

Protein Details
Accession A0A1B8B552    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
35-54GPPSKPSKPSKPPTNQQQISHydrophilic
NLS Segment(s)
PositionSequence
34-42PGPPSKPSK
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKFSALAVLAIATGAFALPGPPSPPGPPSPPGPPGPPSKPSKPSKPPTNQQQISCGNGQSLYCCTNDGNKKNDVTCASFSNGGLGGICNGIQVCCNNNKGTQGCNVGNGGGSITFTSGGGPWLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.05
7 0.07
8 0.09
9 0.11
10 0.12
11 0.16
12 0.19
13 0.23
14 0.25
15 0.27
16 0.3
17 0.33
18 0.34
19 0.34
20 0.35
21 0.38
22 0.4
23 0.43
24 0.44
25 0.47
26 0.53
27 0.56
28 0.62
29 0.65
30 0.7
31 0.73
32 0.75
33 0.77
34 0.78
35 0.82
36 0.77
37 0.68
38 0.66
39 0.58
40 0.52
41 0.44
42 0.34
43 0.23
44 0.2
45 0.18
46 0.12
47 0.11
48 0.1
49 0.09
50 0.09
51 0.09
52 0.15
53 0.23
54 0.26
55 0.28
56 0.29
57 0.31
58 0.31
59 0.34
60 0.3
61 0.26
62 0.23
63 0.22
64 0.21
65 0.21
66 0.2
67 0.18
68 0.15
69 0.12
70 0.1
71 0.08
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.1
81 0.14
82 0.17
83 0.18
84 0.2
85 0.26
86 0.26
87 0.27
88 0.29
89 0.32
90 0.3
91 0.3
92 0.29
93 0.24
94 0.22
95 0.2
96 0.16
97 0.09
98 0.09
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.07