Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8AMM1

Protein Details
Accession A0A1B8AMM1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAPAAKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
5-20AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, cyto 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAKKQKKKWSKGKVKDKAQHAVVLDKTTSEKLYKDVQSYRLVTIATLVDRMKINGSLARQCLADLEEKGIIKPVVTHSKMKIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.93
4 0.93
5 0.9
6 0.86
7 0.82
8 0.73
9 0.66
10 0.56
11 0.51
12 0.42
13 0.36
14 0.29
15 0.21
16 0.21
17 0.18
18 0.18
19 0.14
20 0.13
21 0.14
22 0.21
23 0.22
24 0.25
25 0.26
26 0.29
27 0.32
28 0.33
29 0.3
30 0.25
31 0.23
32 0.18
33 0.16
34 0.13
35 0.09
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.15
47 0.16
48 0.17
49 0.16
50 0.15
51 0.15
52 0.14
53 0.15
54 0.12
55 0.13
56 0.15
57 0.15
58 0.15
59 0.17
60 0.16
61 0.13
62 0.14
63 0.19
64 0.26
65 0.29
66 0.33
67 0.33
68 0.42
69 0.47
70 0.48
71 0.49
72 0.44
73 0.47
74 0.46