Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7YPX7

Protein Details
Accession C7YPX7    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-69KPVNPNKKNKIPYKDRPMKRBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007740  Ribosomal_L49/IMG2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nhe:NECHADRAFT_78909  -  
Pfam View protein in Pfam  
PF05046  Img2  
Amino Acid Sequences MRLLAPRTLSAGCQALLQRPVPLVQRCTYASASQPTFKTHAGYRTNPLDKPVNPNKKNKIPYKDRPMKRFFAPLPTKTEEQLAAAFPYIVRRTPYSQLPVYQKWMSGGNRVIVLIKKVDGDRTRLVEDLATALEVKRSDIRLNPTTQHIEIKGQYFKPAMDWLLNAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.25
5 0.23
6 0.21
7 0.24
8 0.28
9 0.31
10 0.31
11 0.29
12 0.32
13 0.32
14 0.35
15 0.35
16 0.29
17 0.29
18 0.31
19 0.32
20 0.33
21 0.33
22 0.32
23 0.33
24 0.32
25 0.3
26 0.27
27 0.33
28 0.34
29 0.36
30 0.38
31 0.44
32 0.47
33 0.44
34 0.45
35 0.42
36 0.38
37 0.44
38 0.49
39 0.52
40 0.53
41 0.61
42 0.66
43 0.68
44 0.75
45 0.74
46 0.73
47 0.72
48 0.77
49 0.79
50 0.81
51 0.79
52 0.79
53 0.76
54 0.7
55 0.63
56 0.6
57 0.5
58 0.5
59 0.49
60 0.44
61 0.45
62 0.44
63 0.42
64 0.35
65 0.36
66 0.25
67 0.2
68 0.18
69 0.12
70 0.09
71 0.08
72 0.07
73 0.06
74 0.09
75 0.09
76 0.09
77 0.1
78 0.12
79 0.15
80 0.19
81 0.22
82 0.24
83 0.25
84 0.29
85 0.33
86 0.32
87 0.35
88 0.32
89 0.29
90 0.25
91 0.3
92 0.25
93 0.24
94 0.24
95 0.2
96 0.2
97 0.2
98 0.2
99 0.15
100 0.16
101 0.12
102 0.11
103 0.12
104 0.12
105 0.19
106 0.19
107 0.23
108 0.26
109 0.29
110 0.29
111 0.28
112 0.27
113 0.21
114 0.19
115 0.15
116 0.11
117 0.08
118 0.07
119 0.07
120 0.09
121 0.09
122 0.11
123 0.13
124 0.15
125 0.18
126 0.23
127 0.3
128 0.33
129 0.37
130 0.37
131 0.39
132 0.42
133 0.41
134 0.41
135 0.35
136 0.35
137 0.34
138 0.37
139 0.38
140 0.34
141 0.36
142 0.33
143 0.31
144 0.29
145 0.29
146 0.26
147 0.22
148 0.22