Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AFP1

Protein Details
Accession A0A1B8AFP1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
26-45ACSRLISKTRSKSPKPSQLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR018828  RRG7  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF10356  DUF2034  
Amino Acid Sequences MSILFRGLQNAQRRAVKPSKLTGAIACSRLISKTRSKSPKPSQLIYPEAPNKEHSDLVTFLSYVERTSLNKNSTVYRGTHYEYTVADTLSQYGFLLKRVGGHSDRGLDLLGIWTLPSTSQTSKVIIQCKAGARSPSPMYIRELKGAMAVAPPGWRGTDVLGLLVGEKPATKGIQKEIHSADAALGYVCCTKEGELAQLLWNLKAQEMGLDGLSVGVKYGENKSQLVLIRGGEMLPLLDKVKIEKDNVVDVSVIEAEGEGSRKIGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.59
4 0.56
5 0.58
6 0.59
7 0.54
8 0.54
9 0.48
10 0.46
11 0.44
12 0.39
13 0.33
14 0.26
15 0.24
16 0.25
17 0.26
18 0.24
19 0.29
20 0.36
21 0.46
22 0.55
23 0.61
24 0.69
25 0.76
26 0.82
27 0.79
28 0.75
29 0.72
30 0.69
31 0.69
32 0.6
33 0.59
34 0.55
35 0.5
36 0.48
37 0.43
38 0.4
39 0.36
40 0.35
41 0.27
42 0.24
43 0.23
44 0.23
45 0.21
46 0.17
47 0.14
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.12
54 0.17
55 0.23
56 0.23
57 0.26
58 0.27
59 0.29
60 0.3
61 0.31
62 0.27
63 0.24
64 0.26
65 0.26
66 0.27
67 0.24
68 0.23
69 0.2
70 0.22
71 0.2
72 0.16
73 0.14
74 0.12
75 0.12
76 0.11
77 0.1
78 0.07
79 0.08
80 0.08
81 0.09
82 0.1
83 0.09
84 0.12
85 0.13
86 0.17
87 0.16
88 0.18
89 0.19
90 0.19
91 0.19
92 0.17
93 0.16
94 0.11
95 0.1
96 0.08
97 0.06
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.05
104 0.07
105 0.08
106 0.11
107 0.12
108 0.14
109 0.18
110 0.22
111 0.25
112 0.23
113 0.23
114 0.24
115 0.25
116 0.26
117 0.24
118 0.22
119 0.18
120 0.21
121 0.21
122 0.22
123 0.21
124 0.2
125 0.22
126 0.26
127 0.26
128 0.24
129 0.23
130 0.19
131 0.18
132 0.17
133 0.13
134 0.08
135 0.07
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.09
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.07
151 0.06
152 0.04
153 0.04
154 0.05
155 0.06
156 0.07
157 0.08
158 0.1
159 0.17
160 0.24
161 0.25
162 0.3
163 0.3
164 0.31
165 0.3
166 0.28
167 0.22
168 0.15
169 0.14
170 0.09
171 0.07
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.08
178 0.11
179 0.12
180 0.13
181 0.13
182 0.14
183 0.15
184 0.18
185 0.19
186 0.16
187 0.17
188 0.15
189 0.13
190 0.13
191 0.11
192 0.08
193 0.09
194 0.1
195 0.08
196 0.07
197 0.07
198 0.07
199 0.07
200 0.06
201 0.05
202 0.05
203 0.05
204 0.07
205 0.11
206 0.15
207 0.18
208 0.18
209 0.19
210 0.23
211 0.24
212 0.25
213 0.23
214 0.19
215 0.18
216 0.18
217 0.18
218 0.13
219 0.11
220 0.09
221 0.08
222 0.09
223 0.08
224 0.09
225 0.1
226 0.12
227 0.19
228 0.23
229 0.24
230 0.27
231 0.29
232 0.35
233 0.35
234 0.33
235 0.27
236 0.23
237 0.23
238 0.19
239 0.16
240 0.09
241 0.08
242 0.08
243 0.09
244 0.1
245 0.08