Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8AYL7

Protein Details
Accession A0A1B8AYL7    Localization Confidence High Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
154-173ISNPNAQRRERKVRPQQPASHydrophilic
364-391VSGTGNGRRRGKRRVMKKKRILDDQGYMHydrophilic
NLS Segment(s)
PositionSequence
161-215RRERKVRPQQPASAPSKSVKKEPAAPKPATAAKPKQEASAAAPETKHTKAAKQEP
221-266KTATPAPSGGKKPAAALKRGSSGGIMQSFARAAAKPAKPKPAPKKK
370-383GRRRGKRRVMKKKR
430-430K
Subcellular Location(s) nucl 20.5, mito_nucl 11, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MEEYRKFLADRLLSEERPITYRLLSRALDVHVNSAKEMLYDFHKYQNAQKANSVYATYLVYGTKIVNEQYDSDVEMSSSIPDQEETPVSTLTLAREEELRDILAAYQEVISIHVYSLALHPQKDHALLVDLAAQLSEYSTDGDITTASRKYGVISNPNAQRRERKVRPQQPASAPSKSVKKEPAAPKPATAAKPKQEASAAAPETKHTKAAKQEPAASSTKTATPAPSGGKKPAAALKRGSSGGIMQSFARAAAKPAKPKPAPKKKEEEEDAMVLSDDGEADDSDIVATKSSSKPAADPTEIKKRRQEREDALRKMMDDEDEDEDEKEESEKESEQADEEMEEAPEPEPESEAKDDAKEPAEVVSGTGNGRRRGKRRVMKKKRILDDQGYMVTIQEPGWESFSEDEAPPPAKKTAPTPAPATSTGSKAKKPAPKGQGNIMSFFSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.35
4 0.33
5 0.32
6 0.26
7 0.24
8 0.29
9 0.29
10 0.32
11 0.31
12 0.31
13 0.32
14 0.33
15 0.34
16 0.29
17 0.32
18 0.3
19 0.3
20 0.28
21 0.26
22 0.23
23 0.18
24 0.18
25 0.14
26 0.15
27 0.2
28 0.22
29 0.27
30 0.31
31 0.33
32 0.4
33 0.48
34 0.49
35 0.45
36 0.49
37 0.46
38 0.44
39 0.45
40 0.38
41 0.28
42 0.24
43 0.22
44 0.17
45 0.15
46 0.13
47 0.11
48 0.11
49 0.11
50 0.11
51 0.12
52 0.13
53 0.14
54 0.15
55 0.16
56 0.18
57 0.18
58 0.17
59 0.16
60 0.15
61 0.13
62 0.12
63 0.11
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.09
70 0.11
71 0.13
72 0.13
73 0.14
74 0.14
75 0.13
76 0.14
77 0.14
78 0.13
79 0.14
80 0.13
81 0.12
82 0.14
83 0.15
84 0.16
85 0.15
86 0.14
87 0.11
88 0.11
89 0.11
90 0.1
91 0.09
92 0.08
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.07
99 0.07
100 0.08
101 0.08
102 0.08
103 0.09
104 0.15
105 0.16
106 0.16
107 0.17
108 0.18
109 0.2
110 0.21
111 0.19
112 0.13
113 0.14
114 0.13
115 0.13
116 0.14
117 0.12
118 0.11
119 0.1
120 0.09
121 0.07
122 0.07
123 0.07
124 0.04
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.07
132 0.1
133 0.1
134 0.1
135 0.1
136 0.1
137 0.12
138 0.17
139 0.2
140 0.24
141 0.27
142 0.34
143 0.4
144 0.46
145 0.47
146 0.45
147 0.49
148 0.51
149 0.57
150 0.58
151 0.62
152 0.67
153 0.74
154 0.81
155 0.79
156 0.78
157 0.74
158 0.75
159 0.69
160 0.6
161 0.53
162 0.47
163 0.48
164 0.41
165 0.39
166 0.36
167 0.33
168 0.4
169 0.46
170 0.53
171 0.53
172 0.52
173 0.48
174 0.47
175 0.5
176 0.45
177 0.43
178 0.39
179 0.36
180 0.41
181 0.41
182 0.38
183 0.34
184 0.31
185 0.28
186 0.3
187 0.26
188 0.21
189 0.2
190 0.2
191 0.23
192 0.22
193 0.24
194 0.17
195 0.19
196 0.25
197 0.34
198 0.39
199 0.38
200 0.43
201 0.39
202 0.43
203 0.41
204 0.35
205 0.27
206 0.22
207 0.21
208 0.17
209 0.17
210 0.13
211 0.12
212 0.14
213 0.16
214 0.2
215 0.2
216 0.21
217 0.22
218 0.21
219 0.22
220 0.25
221 0.25
222 0.23
223 0.23
224 0.23
225 0.24
226 0.24
227 0.23
228 0.17
229 0.15
230 0.15
231 0.13
232 0.12
233 0.09
234 0.09
235 0.09
236 0.09
237 0.09
238 0.06
239 0.08
240 0.16
241 0.19
242 0.27
243 0.3
244 0.4
245 0.42
246 0.52
247 0.6
248 0.64
249 0.67
250 0.66
251 0.72
252 0.67
253 0.73
254 0.68
255 0.62
256 0.54
257 0.48
258 0.42
259 0.32
260 0.27
261 0.18
262 0.13
263 0.08
264 0.05
265 0.03
266 0.04
267 0.03
268 0.04
269 0.04
270 0.04
271 0.04
272 0.05
273 0.05
274 0.04
275 0.05
276 0.08
277 0.09
278 0.11
279 0.13
280 0.13
281 0.15
282 0.2
283 0.25
284 0.25
285 0.29
286 0.32
287 0.42
288 0.46
289 0.47
290 0.5
291 0.54
292 0.59
293 0.61
294 0.63
295 0.61
296 0.69
297 0.76
298 0.71
299 0.66
300 0.59
301 0.53
302 0.46
303 0.38
304 0.28
305 0.19
306 0.18
307 0.17
308 0.18
309 0.18
310 0.17
311 0.16
312 0.15
313 0.14
314 0.12
315 0.09
316 0.09
317 0.1
318 0.11
319 0.11
320 0.12
321 0.12
322 0.13
323 0.13
324 0.12
325 0.1
326 0.1
327 0.09
328 0.08
329 0.08
330 0.08
331 0.07
332 0.08
333 0.09
334 0.08
335 0.09
336 0.09
337 0.13
338 0.14
339 0.15
340 0.15
341 0.16
342 0.17
343 0.19
344 0.2
345 0.17
346 0.15
347 0.15
348 0.15
349 0.13
350 0.13
351 0.11
352 0.11
353 0.11
354 0.15
355 0.2
356 0.24
357 0.33
358 0.41
359 0.46
360 0.55
361 0.65
362 0.7
363 0.76
364 0.82
365 0.85
366 0.88
367 0.92
368 0.92
369 0.9
370 0.9
371 0.87
372 0.82
373 0.76
374 0.69
375 0.6
376 0.51
377 0.42
378 0.33
379 0.25
380 0.19
381 0.13
382 0.11
383 0.12
384 0.13
385 0.15
386 0.15
387 0.16
388 0.16
389 0.18
390 0.18
391 0.16
392 0.17
393 0.19
394 0.22
395 0.21
396 0.23
397 0.24
398 0.24
399 0.26
400 0.3
401 0.37
402 0.4
403 0.43
404 0.45
405 0.46
406 0.48
407 0.48
408 0.48
409 0.4
410 0.38
411 0.43
412 0.43
413 0.42
414 0.44
415 0.51
416 0.54
417 0.59
418 0.64
419 0.66
420 0.7
421 0.71
422 0.75
423 0.76
424 0.7
425 0.65
426 0.58