Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8ASQ7

Protein Details
Accession A0A1B8ASQ7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
69-97SSSLPSPPPSPRRRRPRRRSGPYPRSSPPHydrophilic
NLS Segment(s)
PositionSequence
77-90PSPRRRRPRRRSGP
Subcellular Location(s) mito 9.5, cyto_mito 8.666, cyto_nucl 8.333, nucl 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSPPQTLSPPRPAGLVVFHVGWVPVYPPGNASQLSAAEVNRDLVSPLASTSGQQPGLASRPDQVSSVPSSSLPSPPPSPRRRRPRRRSGPYPRSSPPSSGEDGGPSYPTPPSTPPPTRTPTPSSGRKKLCSECRHEFSYKNYADHVKCHALEGDEGAPAKPCKQCRTHPEMCRVAINPKRMGTYACVCCIKGHKSCEHTAHKVRGGDGGPDRHPMLLEDGSSPSDGGSDTHPVVLGDVTSSSEEVNHGTPVSVGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.23
4 0.19
5 0.18
6 0.17
7 0.17
8 0.15
9 0.12
10 0.09
11 0.11
12 0.12
13 0.12
14 0.14
15 0.16
16 0.19
17 0.19
18 0.19
19 0.16
20 0.16
21 0.18
22 0.18
23 0.15
24 0.14
25 0.15
26 0.15
27 0.13
28 0.13
29 0.11
30 0.1
31 0.11
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.12
38 0.16
39 0.16
40 0.15
41 0.15
42 0.16
43 0.19
44 0.2
45 0.18
46 0.16
47 0.18
48 0.19
49 0.19
50 0.17
51 0.16
52 0.18
53 0.19
54 0.16
55 0.14
56 0.15
57 0.16
58 0.19
59 0.18
60 0.18
61 0.22
62 0.29
63 0.38
64 0.46
65 0.55
66 0.62
67 0.72
68 0.79
69 0.86
70 0.89
71 0.91
72 0.93
73 0.93
74 0.94
75 0.94
76 0.94
77 0.89
78 0.85
79 0.77
80 0.72
81 0.64
82 0.55
83 0.48
84 0.41
85 0.36
86 0.31
87 0.27
88 0.21
89 0.21
90 0.18
91 0.15
92 0.11
93 0.1
94 0.09
95 0.09
96 0.1
97 0.11
98 0.15
99 0.22
100 0.27
101 0.3
102 0.35
103 0.39
104 0.4
105 0.42
106 0.43
107 0.42
108 0.44
109 0.5
110 0.52
111 0.56
112 0.58
113 0.57
114 0.57
115 0.57
116 0.6
117 0.56
118 0.57
119 0.55
120 0.56
121 0.56
122 0.53
123 0.48
124 0.43
125 0.46
126 0.39
127 0.33
128 0.3
129 0.32
130 0.31
131 0.31
132 0.31
133 0.26
134 0.24
135 0.24
136 0.23
137 0.18
138 0.17
139 0.17
140 0.13
141 0.1
142 0.1
143 0.1
144 0.11
145 0.1
146 0.14
147 0.16
148 0.2
149 0.25
150 0.3
151 0.38
152 0.45
153 0.54
154 0.59
155 0.62
156 0.67
157 0.66
158 0.61
159 0.57
160 0.49
161 0.49
162 0.45
163 0.44
164 0.38
165 0.35
166 0.35
167 0.33
168 0.33
169 0.28
170 0.31
171 0.28
172 0.3
173 0.29
174 0.28
175 0.29
176 0.33
177 0.34
178 0.32
179 0.35
180 0.37
181 0.41
182 0.46
183 0.53
184 0.56
185 0.58
186 0.6
187 0.61
188 0.6
189 0.56
190 0.51
191 0.47
192 0.41
193 0.38
194 0.36
195 0.35
196 0.31
197 0.33
198 0.33
199 0.28
200 0.27
201 0.22
202 0.21
203 0.18
204 0.17
205 0.15
206 0.16
207 0.17
208 0.17
209 0.16
210 0.11
211 0.1
212 0.09
213 0.09
214 0.1
215 0.13
216 0.13
217 0.14
218 0.14
219 0.14
220 0.14
221 0.13
222 0.11
223 0.07
224 0.07
225 0.08
226 0.09
227 0.09
228 0.09
229 0.09
230 0.1
231 0.11
232 0.12
233 0.12
234 0.12
235 0.11
236 0.12