Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AAJ0

Protein Details
Accession A0A1B8AAJ0   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-139SFRCYHQLDRDHPRRRNCKQRFEIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 14.5, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR040165  Diminuto-like  
IPR036318  FAD-bd_PCMH-like_sf  
IPR016169  FAD-bd_PCMH_sub2  
IPR006094  Oxid_FAD_bind_N  
Gene Ontology GO:0050614  F:delta24-sterol reductase activity  
GO:0050660  F:flavin adenine dinucleotide binding  
Pfam View protein in Pfam  
PF01565  FAD_binding_4  
Amino Acid Sequences MDTHKEAILCIAERVRSFHIRDEPFRLYHGSTNSTRHSDRNVDNVVDTSGLKNILEVDKGKKTVLVESNVTMEALVDATLPHGLVPLVVMEFPAITVGGGFSGTSGESSSFSIWSFRCYHQLDRDHPRRRNCKQRFEIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.29
4 0.3
5 0.35
6 0.41
7 0.44
8 0.47
9 0.51
10 0.49
11 0.44
12 0.44
13 0.4
14 0.33
15 0.32
16 0.31
17 0.29
18 0.28
19 0.32
20 0.33
21 0.36
22 0.35
23 0.33
24 0.34
25 0.36
26 0.36
27 0.38
28 0.37
29 0.32
30 0.31
31 0.3
32 0.25
33 0.19
34 0.17
35 0.11
36 0.09
37 0.09
38 0.08
39 0.07
40 0.08
41 0.08
42 0.1
43 0.11
44 0.14
45 0.16
46 0.17
47 0.17
48 0.17
49 0.17
50 0.2
51 0.22
52 0.21
53 0.19
54 0.19
55 0.2
56 0.18
57 0.17
58 0.12
59 0.08
60 0.06
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.03
78 0.03
79 0.03
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.08
96 0.08
97 0.09
98 0.09
99 0.12
100 0.12
101 0.16
102 0.19
103 0.2
104 0.27
105 0.3
106 0.37
107 0.42
108 0.5
109 0.54
110 0.61
111 0.7
112 0.72
113 0.75
114 0.79
115 0.81
116 0.84
117 0.87
118 0.86
119 0.87