Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8A3E2

Protein Details
Accession A0A1B8A3E2   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-113QSLTKSKRKGTIKTKKGKNKIKQASVVHydrophilic
NLS Segment(s)
PositionSequence
45-48KKKK
91-129KSKRKGTIKTKKGKNKIKQASVVEKAPARHLTKQGQKKI
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSVRSKFDARIAASPNEAKSVEPPKMTTANEKKMTAEAGLQKTTKKKKKSSAVTMIEEVTTAEQSLNRAASVSKQSLVKTTGSNVKQSLTKSKRKGTIKTKKGKNKIKQASVVEKAPARHLTKQGQKKIAATVKMNRTKMGAKVGTNIRDGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.33
4 0.3
5 0.24
6 0.26
7 0.3
8 0.3
9 0.29
10 0.29
11 0.3
12 0.35
13 0.36
14 0.4
15 0.42
16 0.47
17 0.5
18 0.5
19 0.46
20 0.43
21 0.42
22 0.33
23 0.29
24 0.26
25 0.25
26 0.28
27 0.27
28 0.3
29 0.37
30 0.47
31 0.5
32 0.52
33 0.56
34 0.63
35 0.72
36 0.79
37 0.8
38 0.8
39 0.78
40 0.73
41 0.66
42 0.56
43 0.46
44 0.36
45 0.26
46 0.16
47 0.1
48 0.06
49 0.05
50 0.05
51 0.06
52 0.07
53 0.07
54 0.06
55 0.07
56 0.07
57 0.09
58 0.12
59 0.12
60 0.13
61 0.14
62 0.15
63 0.17
64 0.18
65 0.17
66 0.14
67 0.16
68 0.21
69 0.21
70 0.23
71 0.21
72 0.21
73 0.22
74 0.23
75 0.32
76 0.31
77 0.39
78 0.43
79 0.49
80 0.56
81 0.59
82 0.67
83 0.67
84 0.71
85 0.73
86 0.77
87 0.8
88 0.82
89 0.86
90 0.88
91 0.86
92 0.86
93 0.85
94 0.82
95 0.8
96 0.76
97 0.74
98 0.68
99 0.61
100 0.53
101 0.46
102 0.4
103 0.37
104 0.38
105 0.34
106 0.35
107 0.39
108 0.45
109 0.52
110 0.61
111 0.64
112 0.64
113 0.63
114 0.59
115 0.62
116 0.6
117 0.55
118 0.51
119 0.52
120 0.55
121 0.61
122 0.6
123 0.52
124 0.49
125 0.48
126 0.47
127 0.47
128 0.42
129 0.35
130 0.42
131 0.48
132 0.48