Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z9W2

Protein Details
Accession C7Z9W2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-108GKPSSGRIEKKRGDKRKQKKSKIVFAPYATHydrophilic
NLS Segment(s)
PositionSequence
82-118SSGRIEKKRGDKRKQKKSKIVFAPYATRSKGKKKRSS
Subcellular Location(s) mito 16.5, mito_nucl 14, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG nhe:NECHADRAFT_81891  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSTRKANNRRLVANVFGPAESARAERLSAKLLELAQQPKPESSDVKMSVDEDNEESNEKEDAEEVTTMDVDSGKPSSGRIEKKRGDKRKQKKSKIVFAPYATRSKGKKKRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.73
4 0.66
5 0.59
6 0.51
7 0.43
8 0.34
9 0.28
10 0.25
11 0.19
12 0.16
13 0.13
14 0.11
15 0.1
16 0.09
17 0.1
18 0.11
19 0.12
20 0.15
21 0.14
22 0.14
23 0.15
24 0.14
25 0.17
26 0.2
27 0.22
28 0.21
29 0.24
30 0.24
31 0.22
32 0.24
33 0.22
34 0.19
35 0.18
36 0.22
37 0.21
38 0.22
39 0.21
40 0.21
41 0.2
42 0.18
43 0.17
44 0.11
45 0.1
46 0.09
47 0.1
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.13
70 0.2
71 0.28
72 0.34
73 0.43
74 0.49
75 0.6
76 0.7
77 0.75
78 0.79
79 0.81
80 0.86
81 0.87
82 0.92
83 0.92
84 0.92
85 0.91
86 0.91
87 0.9
88 0.88
89 0.83
90 0.77
91 0.74
92 0.68
93 0.65
94 0.57
95 0.53
96 0.51
97 0.55
98 0.6