Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AE14

Protein Details
Accession A0A1B8AE14    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKSSSKPMGPKKKDPLPTTHydrophilic
NLS Segment(s)
PositionSequence
4-16RKSSSKPMGPKKK
Subcellular Location(s) cyto 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPMGPKKKDPLPTTFACLFCNHENSVSVKLDKKAGVGQLDCRVCGQKFQCAVNYLSAAVDVYGEWVDAADAVAKEDNAEPGYGGTSRGGSGRGNRTAVEEDYDDQYGDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.77
5 0.72
6 0.68
7 0.62
8 0.59
9 0.55
10 0.47
11 0.39
12 0.36
13 0.34
14 0.31
15 0.32
16 0.26
17 0.22
18 0.23
19 0.23
20 0.26
21 0.23
22 0.23
23 0.22
24 0.23
25 0.25
26 0.23
27 0.22
28 0.21
29 0.21
30 0.22
31 0.2
32 0.21
33 0.25
34 0.25
35 0.24
36 0.22
37 0.22
38 0.18
39 0.23
40 0.21
41 0.19
42 0.22
43 0.23
44 0.24
45 0.24
46 0.25
47 0.21
48 0.2
49 0.15
50 0.12
51 0.11
52 0.08
53 0.06
54 0.05
55 0.03
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.05
67 0.06
68 0.06
69 0.07
70 0.07
71 0.09
72 0.08
73 0.08
74 0.07
75 0.07
76 0.09
77 0.08
78 0.09
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.11
85 0.18
86 0.24
87 0.28
88 0.29
89 0.29
90 0.32
91 0.34
92 0.33
93 0.3
94 0.25
95 0.23
96 0.25
97 0.25
98 0.21
99 0.17