Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8AHE8

Protein Details
Accession A0A1B8AHE8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-24EDGRKGPRFGHRPHRPRPPGBasic
NLS Segment(s)
PositionSequence
8-24RKGPRFGHRPHRPRPPG
Subcellular Location(s) nucl 11, mito 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MAEMEDGRKGPRFGHRPHRPRPPGYWKVVPSKLIRPRHQVVGIRINKLGPCKQELDGGTGLRLSTTIAAIET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.61
3 0.66
4 0.74
5 0.81
6 0.78
7 0.76
8 0.77
9 0.76
10 0.73
11 0.71
12 0.7
13 0.63
14 0.63
15 0.61
16 0.56
17 0.49
18 0.5
19 0.52
20 0.53
21 0.53
22 0.52
23 0.51
24 0.51
25 0.53
26 0.48
27 0.44
28 0.46
29 0.46
30 0.4
31 0.38
32 0.35
33 0.32
34 0.32
35 0.31
36 0.24
37 0.24
38 0.25
39 0.25
40 0.3
41 0.29
42 0.29
43 0.28
44 0.26
45 0.23
46 0.21
47 0.19
48 0.14
49 0.13
50 0.09
51 0.07
52 0.07