Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AMD5

Protein Details
Accession A0A1B8AMD5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-32VPKSRGCNNCLKQKKKCDQQKPVCSRCTRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MPGVPKSRGCNNCLKQKKKCDQQKPVCSRCTRLNIACKGSGERKYVFKSVSFTKLKNASLRKLRNKESRDVPKNCENEGVNIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.78
4 0.84
5 0.84
6 0.87
7 0.87
8 0.88
9 0.9
10 0.91
11 0.91
12 0.87
13 0.84
14 0.76
15 0.69
16 0.65
17 0.61
18 0.56
19 0.52
20 0.53
21 0.51
22 0.51
23 0.48
24 0.42
25 0.38
26 0.37
27 0.36
28 0.31
29 0.27
30 0.28
31 0.3
32 0.32
33 0.29
34 0.25
35 0.24
36 0.25
37 0.32
38 0.31
39 0.28
40 0.32
41 0.36
42 0.38
43 0.41
44 0.43
45 0.42
46 0.49
47 0.58
48 0.63
49 0.66
50 0.72
51 0.74
52 0.74
53 0.74
54 0.75
55 0.76
56 0.76
57 0.73
58 0.71
59 0.7
60 0.69
61 0.62
62 0.58
63 0.48
64 0.43