Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8A8S7

Protein Details
Accession A0A1B8A8S7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-108PWPTPVSRPNRLPRRQPFQAPHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 4, extr 4, plas 3
Family & Domain DBs
Amino Acid Sequences MDAPLLFRVSKSGSALRRLVAGQCITITIIVMRWRWREVVIARLLLHVLHLLRIPLLLPRALHPSSVGSLVRRSRARKGSRTVASVPWPTPVSRPNRLPRRQPFQAPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.33
4 0.33
5 0.31
6 0.29
7 0.27
8 0.23
9 0.18
10 0.16
11 0.16
12 0.14
13 0.13
14 0.11
15 0.06
16 0.08
17 0.1
18 0.12
19 0.15
20 0.17
21 0.19
22 0.19
23 0.2
24 0.23
25 0.22
26 0.27
27 0.25
28 0.24
29 0.23
30 0.23
31 0.22
32 0.16
33 0.15
34 0.09
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.07
46 0.08
47 0.14
48 0.14
49 0.14
50 0.13
51 0.14
52 0.14
53 0.16
54 0.15
55 0.11
56 0.16
57 0.18
58 0.24
59 0.28
60 0.3
61 0.37
62 0.46
63 0.53
64 0.55
65 0.6
66 0.64
67 0.63
68 0.65
69 0.59
70 0.54
71 0.52
72 0.48
73 0.42
74 0.36
75 0.33
76 0.29
77 0.3
78 0.33
79 0.34
80 0.38
81 0.47
82 0.53
83 0.63
84 0.7
85 0.77
86 0.8
87 0.82
88 0.82